DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8195 and nstp-7

DIOPT Version :9

Sequence 1:NP_611049.1 Gene:CG8195 / 36725 FlyBaseID:FBgn0034032 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_503252.3 Gene:nstp-7 / 187072 WormBaseID:WBGene00019451 Length:356 Species:Caenorhabditis elegans


Alignment Length:300 Identity:61/300 - (20%)
Similarity:114/300 - (38%) Gaps:73/300 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 MAEVREMSAHEATDALMARLSYAASLRIRRQKTHH-------KTAKTALLFCLLWFAANYFFQLA 196
            |.|:.::|.     .|:..|....|:|...:|.|.       :|.|.::. .|::...|..:.:|
 Worm    68 MMEILKLSF-----CLIIVLIETRSIRKTAKKLHKNIWQNWWETMKVSVP-ALVYAVQNNLYYVA 126

  Fly   197 LEMDEAAMITLVSSTSSFFIICLAAVFPSATGDKLTITKVIAVAMNIGGVVAITMNDLHDTKMTR 261
            |...:|   |..|.|....|:..|.:.......||:..:.:|..|.:.||:.:.:::.:..:...
 Worm   127 LANIDA---TTYSVTLQLRILTTAILSVVLLSKKLSGYQWMAQGMALIGVIVVQLDNSNSRREIA 188

  Fly   262 G--------VLLALFSAFFYAAYLVFVKRKSDTEEKVDIPLFFGFVGLWNMLLLWPIFFILHFTK 318
            |        ||...:::.|...|...:.:.|..:             :|...:...|..:| |..
 Worm   189 GNFWLGLASVLGMCWTSAFAGVYFEKMLKNSSAD-------------VWIQNIRLSILTLL-FAG 239

  Fly   319 IETFELPSQGQFALLFLNG---LVGTVLSEALWLWGCFLTS--SLIGTLAMSLQIPLAILFDVLL 378
            |           .:|..:|   :.|.:...  |.|..:|.:  :.||.|.:||.:..|   |.::
 Worm   240 I-----------TMLSKDGDAIITGNIFHG--WTWIVWLVTIGNSIGGLCISLVMKYA---DNVM 288

  Fly   379 KNKPYSPMFYMGSIPI-FVALVFVSLLMRNDDSDPLMKLF 417
            |.       |..|:.| |.::|.:.|      .|.|:.|:
 Worm   289 KT-------YCQSLAIGFTSIVSICL------GDRLLSLY 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8195NP_611049.1 2A78 153..399 CDD:273359 53/266 (20%)
EamA 260..403 CDD:279264 30/156 (19%)
nstp-7NP_503252.3 RhaT 35..332 CDD:223769 61/299 (20%)
EamA 108..330 CDD:304911 51/254 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.