DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8195 and nstp-4

DIOPT Version :9

Sequence 1:NP_611049.1 Gene:CG8195 / 36725 FlyBaseID:FBgn0034032 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_493723.3 Gene:nstp-4 / 173428 WormBaseID:WBGene00015404 Length:339 Species:Caenorhabditis elegans


Alignment Length:308 Identity:69/308 - (22%)
Similarity:104/308 - (33%) Gaps:108/308 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 RFSKMAEV--REMSAHEAT--DALMARLSYAASLRIRRQKTHHKTAKTALLFC----LLWF---- 187
            |||.|...  ||:.|...|  |:|                   |.|..|:::.    ||:|    
 Worm    71 RFSGMLNELNREIFASPQTRADSL-------------------KVAVPAIMYVIQNNLLFFALKK 116

  Fly   188 --AANY--FFQLALEMDEAAMITLVSSTSSFF-----IICLAAV----FPSATGDKLTITKVIA- 238
              ||.|  .:||.:.......:|::..:...:     |:..|.|    :||  ||..|.....| 
 Worm   117 LDAATYQVTYQLKILTTAIFSVTMLGKSLHRYNWMALILLTAGVALVQYPS--GDSTTSKSTAAE 179

  Fly   239 --VAMNIGGVVAITMNDLHDTKMTRGVLLALFSAFFYAAYLVFVKRKSDTEEKVDIPL------F 295
              .:.||.|:.|              ||.|.||:.|...|...:.:.|    ||.:.:      |
 Worm   180 HDASDNILGLGA--------------VLAACFSSGFAGVYFEKILKTS----KVSLWIRNIQLAF 226

  Fly   296 FGFVGLWNMLLLWPIFFILHFTKIETFELPSQGQFALLFLNGLVGTVLSEALWLWGCFLTSSLIG 360
            |...|.  :|:.|         ..:...:...|     ||.|..|.:     |:   .:.....|
 Worm   227 FSVFGA--LLVCW---------LYDWQAISDDG-----FLRGYNGVI-----WI---VVLLQAYG 267

  Fly   361 TLAMSLQIPLAILFDVLLKNKPYSPMFYMGSIPIFVALVFVSLLMRND 408
            .|.::|.:..|   |.:||....|....:.|        |.|.|:..|
 Worm   268 GLVIALVVKYA---DNILKGFAVSLSIILSS--------FTSWLVLGD 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8195NP_611049.1 2A78 153..399 CDD:273359 56/275 (20%)
EamA 260..403 CDD:279264 31/148 (21%)
nstp-4NP_493723.3 Nuc_sug_transp 7..326 CDD:282054 69/308 (22%)
EamA 95..325 CDD:304911 59/265 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.