Sequence 1: | NP_611049.1 | Gene: | CG8195 / 36725 | FlyBaseID: | FBgn0034032 | Length: | 449 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001128130.1 | Gene: | SLC35G1 / 159371 | HGNCID: | 26607 | Length: | 365 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 48/206 - (23%) |
---|---|---|---|
Similarity: | 90/206 - (43%) | Gaps: | 35/206 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 191 YFFQLALEMDEAAMITLVSS--TSSFFIICLAAVFP--SATGDKLTITKVIAVAMN--IGGVVAI 249
Fly 250 TMNDLHDTKMTRGVLLALFSAFFYAAYLVFVKRKSDTEEKVDIPLFFGFVGLWNMLLLWPIFFIL 314
Fly 315 HFTKIETFELPSQG--QFALLFLN--GLVGTVLSEALWLWGCFLTSSL----IGTLAM--SLQIP 369
Fly 370 LAILFDVLLKN 380 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8195 | NP_611049.1 | 2A78 | 153..399 | CDD:273359 | 48/206 (23%) |
EamA | 260..403 | CDD:279264 | 29/131 (22%) | ||
SLC35G1 | NP_001128130.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..33 | ||
RhaT | 70..359 | CDD:223769 | 48/206 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0697 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |