DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8195 and SLC35G1

DIOPT Version :9

Sequence 1:NP_611049.1 Gene:CG8195 / 36725 FlyBaseID:FBgn0034032 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001128130.1 Gene:SLC35G1 / 159371 HGNCID:26607 Length:365 Species:Homo sapiens


Alignment Length:206 Identity:48/206 - (23%)
Similarity:90/206 - (43%) Gaps:35/206 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 YFFQLALEMDEAAMITLVSS--TSSFFIICLAAVFP--SATGDKLTITKVIAVAMN--IGGVVAI 249
            |:....:.:.:|.:||..|.  ||.|..|||...:.  .|.....|||.||.:...  :.|....
Human   148 YYAYQTMSLADATVITFSSPVFTSIFAWICLKEKYSPWDALFTVFTITGVILIVRPPFLFGSDTS 212

  Fly   250 TMNDLHDTKMTRGVLLALFSAFFYAAYLVFVKRKSDTEEKVDIPLFFGFVGLWNMLLLWPIFFIL 314
            .|.:.:...: :|...|:.||.|.|:.||.:::..   :.||.     |:.:|..::|..:..::
Human   213 GMEESYSGHL-KGTFAAIGSAVFAASTLVILRKMG---KSVDY-----FLSIWYYVVLGLVESVI 268

  Fly   315 HFTKIETFELPSQG--QFALLFLN--GLVGTVLSEALWLWGCFLTSSL----IGTLAM--SLQIP 369
            ..:.:..:.||..|  :..|:|:.  ||.|.:          |:|.:|    .|.:|:  ::.:.
Human   269 ILSVLGEWSLPYCGLDRLFLIFIGLFGLGGQI----------FITKALQIEKAGPVAIMKTMDVV 323

  Fly   370 LAILFDVLLKN 380
            .|.:|.::..|
Human   324 FAFIFQIIFFN 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8195NP_611049.1 2A78 153..399 CDD:273359 48/206 (23%)
EamA 260..403 CDD:279264 29/131 (22%)
SLC35G1NP_001128130.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
RhaT 70..359 CDD:223769 48/206 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.