DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8195 and SLC35B1

DIOPT Version :9

Sequence 1:NP_611049.1 Gene:CG8195 / 36725 FlyBaseID:FBgn0034032 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_006721695.1 Gene:SLC35B1 / 10237 HGNCID:20798 Length:393 Species:Homo sapiens


Alignment Length:105 Identity:30/105 - (28%)
Similarity:49/105 - (46%) Gaps:10/105 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 VGLWNMLLL-WPIFFILHFTKIETFELPSQGQFALLFLNGLVGTVLSEALWLWGCFLTSSLIGTL 362
            :.||:.||| ..|.|.....:..:|   ::...|:::...|.|  |:.||.....|:|....|.|
Human   279 INLWSTLLLGMGILFTGELWEFLSF---AERYPAIIYNILLFG--LTSALGQSFIFMTVVYFGPL 338

  Fly   363 AMSLQIP----LAILFDVLLKNKPYSPMFYMGSIPIFVAL 398
            ..|:...    ..||..|:|...|.|||.::|::.:|:.|
Human   339 TCSIITTTRKFFTILASVILFANPISPMQWVGTVLVFLGL 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8195NP_611049.1 2A78 153..399 CDD:273359 30/105 (29%)
EamA 260..403 CDD:279264 30/105 (29%)
SLC35B1XP_006721695.1 UAA 53..380 CDD:312076 30/105 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.