DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8195 and LOC101884357

DIOPT Version :9

Sequence 1:NP_611049.1 Gene:CG8195 / 36725 FlyBaseID:FBgn0034032 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_005162180.1 Gene:LOC101884357 / 101884357 -ID:- Length:1587 Species:Danio rerio


Alignment Length:170 Identity:43/170 - (25%)
Similarity:66/170 - (38%) Gaps:55/170 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 VPIRSP------HLGAGGQS------NGTSNS--ISGTESDDS---SVRSVRFSKMAEVREMSAH 148
            ||.|:|      :..|.|||      |||.::  ::|..|...   |:..|..:|:.     ||.
Zfish   488 VPSRNPQQYRVVYHTAEGQSLNELVVNGTESTTLLTGLSSQTQYHLSIFPVYENKVG-----SAL 547

  Fly   149 EAT---------DALMARLSYAASLRIRRQKTHHKTAKTALLFCLLWFAANYFFQLALEMDEA-- 202
            ..|         :||....|.|:|||:|.|     .|..|..:..|:.|.|     ..|.|:|  
Zfish   548 RGTFTTLPLAIPEALEVTASSASSLRVRWQ-----PAAGATQYMALYSALN-----DGEPDDAKE 602

  Fly   203 ----------AMITLVSSTSSFFIICLAAVFPSATGDKLT 232
                      .::.|:.||.  :.:.|.|::.....|.:|
Zfish   603 VKFGPAQTDVELVDLIPSTD--YSVTLYALYDEDPSDPIT 640

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8195NP_611049.1 2A78 153..399 CDD:273359 24/92 (26%)
EamA 260..403 CDD:279264
LOC101884357XP_005162180.1 fn3 51..121 CDD:278470
vWA_collagen_alphaI-XII-like 265..428 CDD:238759
fn3 467..544 CDD:278470 16/55 (29%)
FN3 559..636 CDD:214495 22/88 (25%)
FN3 651..734 CDD:238020
FN3 738..825 CDD:238020
fn3 831..910 CDD:278470
fn3 934..996 CDD:278470
LamG 1037..1230 CDD:304605
Collagen 1267..1331 CDD:189968
Collagen 1347..1406 CDD:189968
Collagen 1507..1565 CDD:189968
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.