Sequence 1: | NP_611049.1 | Gene: | CG8195 / 36725 | FlyBaseID: | FBgn0034032 | Length: | 449 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001122283.1 | Gene: | slc35a1 / 100004536 | ZFINID: | ZDB-GENE-080716-17 | Length: | 337 | Species: | Danio rerio |
Alignment Length: | 323 | Identity: | 60/323 - (18%) |
---|---|---|---|
Similarity: | 111/323 - (34%) | Gaps: | 99/323 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 181 LFCL---LWFAANYFFQLALEMDEAAMITLVSSTSSFFIICLAAVFP---------SATGD---- 229
Fly 230 ----------------KLTITKVIAVAMNIGGVVAITMND---------------------LHDT 257
Fly 258 KMTRGVLLALFSAFFYAAYLVFVKRKSDTEEKVDIPL--FFGFVGLWNMLLLWPIFFILHFTKI- 319
Fly 320 ETFELPSQGQFALLFLNGLVGT-----------VLSEALWL----WGCFL--------------- 354
Fly 355 --TSSLIGTLAMSLQIPLAILFDVLLKNKPYSPMFYMGSIPIFVALVFVSLLMRNDDSDPLMK 415 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8195 | NP_611049.1 | 2A78 | 153..399 | CDD:273359 | 56/305 (18%) |
EamA | 260..403 | CDD:279264 | 32/177 (18%) | ||
slc35a1 | NP_001122283.1 | Nuc_sug_transp | 6..312 | CDD:282054 | 56/308 (18%) |
nst | 88..311 | CDD:129885 | 39/226 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0697 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |