DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8195 and slc35g1

DIOPT Version :9

Sequence 1:NP_611049.1 Gene:CG8195 / 36725 FlyBaseID:FBgn0034032 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_001341822.1 Gene:slc35g1 / 100001920 ZFINID:ZDB-GENE-121214-166 Length:409 Species:Danio rerio


Alignment Length:209 Identity:44/209 - (21%)
Similarity:89/209 - (42%) Gaps:39/209 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 YFFQLALEMDEAAMITLVSSTSSFFIICLAAVFPSATGDKLTITKVIAVAMNIGGVVAITMNDLH 255
            |:..|.:.:.:|   |::..::..|...||.:|   ..::.||..|:.....:.||:.|......
Zfish   189 YYAVLQMPLADA---TVIMFSNPVFTALLAWIF---LKERCTIWDVVFTVFTLTGVILIARPPFL 247

  Fly   256 DTKMTRGV----------LLALFSAFFYAAYLVFVKRKSDTEEKVDIPLFFGFVGLWNMLLLWPI 310
            ......|:          .:|.||....||..:.:.||  ..::|..     |:.:|...:|..|
Zfish   248 FGGELSGIEGDYSSHIKGTVAAFSGAVGAACTMVILRK--IGKRVHY-----FLSVWYYAVLGLI 305

  Fly   311 FFILHFTKIETFELPSQG--QFALLFLNGLVGTVLSEALWLWGCFLTSSL----IGTLAM--SLQ 367
            ..::....::.:.:||.|  ::.|:.: |::| :..:|      |||.:|    .|.:|:  ::.
Zfish   306 ECVVVLFILDEWTIPSCGWDRWTLMAI-GVLG-IAGQA------FLTKALQIEKAGPVALMRTMD 362

  Fly   368 IPLAILFDVLLKNK 381
            :.||.:...|..|:
Zfish   363 VVLAFVLQFLFLNR 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8195NP_611049.1 2A78 153..399 CDD:273359 44/209 (21%)
EamA 260..403 CDD:279264 30/140 (21%)
slc35g1XP_001341822.1 EamA 110..243 CDD:279264 14/59 (24%)
RhaT 111..400 CDD:223769 44/209 (21%)
EamA 263..398 CDD:279264 29/129 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.