DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8192 and CG14301

DIOPT Version :9

Sequence 1:NP_611047.2 Gene:CG8192 / 36723 FlyBaseID:FBgn0034030 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_650734.2 Gene:CG14301 / 42235 FlyBaseID:FBgn0038632 Length:196 Species:Drosophila melanogaster


Alignment Length:154 Identity:35/154 - (22%)
Similarity:67/154 - (43%) Gaps:34/154 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 QPQQQRQLYEYSEEDQEEAPRPVYANRNAKQQSNYLKIQGQLKKPLSEESEEEEEEVEEPDR--- 135
            :|:.|:.|    |.|:           |..|:.:..:|......|...|..|..:.:  |.|   
  Fly    42 EPEPQQDL----ENDE-----------NGSQEKDLPEIPDNFLSPSVREYLELGKSI--PGRPGV 89

  Fly   136 ---LSTLLSKSSFSCTDRN-SGYYADESLSCEVFHYCQ-ESQKHSWICPEGFTFHQIHLICMPPS 195
               :.:.:..::|.|.::. .|::||....|:.:|||. :.::.:::||.|..|.|...:|    
  Fly    90 DYPILSAVPYTNFYCDEQEYPGFFADMETRCQGWHYCDIDGRQATFLCPNGTQFSQAVFVC---- 150

  Fly   196 HD---NI-CKQSSKYHIVNDYLYK 215
             |   |: |..|.:.:.:|..||:
  Fly   151 -DWWFNVRCDLSPRLYAINARLYQ 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8192NP_611047.2 CBM_14 147..200 CDD:279884 16/58 (28%)
CG14301NP_650734.2 CBM_14 104..156 CDD:279884 15/56 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.