DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8192 and CG14304

DIOPT Version :9

Sequence 1:NP_611047.2 Gene:CG8192 / 36723 FlyBaseID:FBgn0034030 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001138080.1 Gene:CG14304 / 42232 FlyBaseID:FBgn0038629 Length:1136 Species:Drosophila melanogaster


Alignment Length:378 Identity:80/378 - (21%)
Similarity:155/378 - (41%) Gaps:87/378 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 QAQTHLA----YRQQPQQQRQLYEYSEEDQEEAPRPVYANRNAKQQSNYLKIQGQLKKPLSEESE 124
            |.||.:|    :..:.:...|.|:|:...:||        .:::.:....:.:|..|.|   ...
  Fly   789 QTQTIVANPPQHHDEHKSSAQDYDYNTGSEEE--------HHSQSEEAIARPKGPNKHP---GPS 842

  Fly   125 EEEEEVEEPDRLSTLLSKSSFSCT-DRNSGYYADESLSCEVFHYCQ-ESQKHSWICPEGFTFHQI 187
            .....::.|:...  :.::||.|| .|..|::.|...:|:|:|||. ...|.|::||.|..|.||
  Fly   843 TGRPGIDYPNYAE--IPQTSFECTKQRYKGFFGDPETNCQVWHYCDLNGGKASFLCPNGTIFSQI 905

  Fly   188 HLICMPPSHD---NI-CKQSSKYHIVNDYLYKPINLQEHQSKPNVTLRYSERYFPENY------- 241
            .|.|     |   |: |..:::.:::|:.|||.|            |.::.: |||:|       
  Fly   906 ALTC-----DWWFNVKCSTTAQLYVLNERLYKYI------------LPFNPK-FPEDYNGPIVDK 952

  Fly   242 YEHERYDDEEEQLPAAPRPRIQQQHH-QQQHQQPQQQHRQVLAYQQPQQQPQVRVQYQQPQQH-- 303
            |...::.:.||::      |:::|.. .|:.|:|:         :.|...|.:...::...:|  
  Fly   953 YLAMKFQEMEEKM------RLEKQRKAAQEAQKPE---------EAPSTLPALPKNHKPEPKHGS 1002

  Fly   304 ----QHHQQQAQPQAQVVTQIRHQPQPQPTTLAYRKPQPVTTVQPQLQLHQLHQPQLQLHQQRPQ 364
                |.::|.::....:..:| .....:.|...|.:..|.|.:.|      ......|....:|.
  Fly  1003 GINAQVYEQSSEKNLLIDDEI-DDISERGTYDTYDQTAPTTIMAP------TSTQDTQSFVLKPI 1060

  Fly   365 TLAPTVTPAPYRFFTAAP----------QLQHLQQQQQQVFRTPEEINISLQQ 407
            .::.|..|.|...|...|          .||.|::.::...:|.|...:|:::
  Fly  1061 VVSSTPQPLPEIDFEVEPTAPGSSEEEDHLQSLRETKEAEKKTRESTKVSVEK 1113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8192NP_611047.2 CBM_14 147..200 CDD:279884 22/58 (38%)
CG14304NP_001138080.1 CBM_14 863..917 CDD:279884 22/58 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.