DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8192 and mtg

DIOPT Version :9

Sequence 1:NP_611047.2 Gene:CG8192 / 36723 FlyBaseID:FBgn0034030 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_731221.2 Gene:mtg / 40970 FlyBaseID:FBgn0260386 Length:556 Species:Drosophila melanogaster


Alignment Length:240 Identity:53/240 - (22%)
Similarity:86/240 - (35%) Gaps:65/240 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 PQQQRQLYEYSEEDQEEAPRPVYANRNAKQQSNYLKIQGQLKKPLSEESEEEEEEVEEPDRLSTL 139
            |:.|:.|.|:.......||:..|                    |:..:...::....:.|     
  Fly   354 PRPQKSLAEHKVSKVMNAPKEYY--------------------PVGYDKNFDDNFKSKVD----- 393

  Fly   140 LSKSSFSCTDRN--SGYYADESLSCEVFHYCQESQ----KHSWICPEGFTFHQIHLICMPPSHDN 198
            |..:||||..:.  .|.|||..|.|.|||.|..:.    :.|::|||...|.|..|.|      |
  Fly   394 LPPTSFSCAKQKHFPGLYADTDLGCMVFHVCALTDDGMVRKSFLCPENTLFDQTILKC------N 452

  Fly   199 -----ICKQSSKYHIVNDYLYKPINLQEHQSKPNVTLRYSERYFPENYYEHERYDDEE------- 251
                 .|..|:..:..|..:.|...|.:       :|.|..:|  .....||:..|::       
  Fly   453 WWFYVDCSSSTSVYDSNIPISKSYQLMK-------SLTYFSKY--AGGQRHEQGGDKDENALDID 508

  Fly   252 ---EQLPAAPRPRIQ----QQHHQQQHQQPQQQHRQVLAYQQPQQ 289
               |.:....|.:.|    :...::|...|::.|..|:..:..||
  Fly   509 SLRESMEGVARRQEQAKKAELRVEEQRSMPKEDHEHVVPAEAEQQ 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8192NP_611047.2 CBM_14 147..200 CDD:279884 20/63 (32%)
mtgNP_731221.2 CBM_14 409..459 CDD:279884 19/55 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.