DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Runx2 and RunxA

DIOPT Version :9

Sequence 1:XP_038939882.1 Gene:Runx2 / 367218 RGDID:2282 Length:652 Species:Rattus norvegicus
Sequence 2:NP_001259747.1 Gene:RunxA / 4379817 FlyBaseID:FBgn0083981 Length:663 Species:Drosophila melanogaster


Alignment Length:286 Identity:131/286 - (45%)
Similarity:160/286 - (55%) Gaps:65/286 - (22%)


- Green bases have known domain annotations that are detailed below.


  Rat   212 RTMVEIIADHPAELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGEVPDGTVVTVMAGNDENY 276
            ||:.:.:.:||.||:||.||.|:|:|||.|||.|||||||||||:||::.|||:|||.|||||||
  Fly    86 RTLGDFLTEHPGELIRTSSPLFVCTVLPPHWRSNKTLPVAFKVVSLGDIMDGTMVTVRAGNDENY 150

  Rat   277 SAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRR 341
            .|||||.:||||||||:||||||||||||||||||||||.||||.:|||::||||||||||||| 
  Fly   151 CAELRNCTAVMKNQVAKFNDLRFVGRSGRGKSFTLTITVSTNPPHIATYNKAIKVTVDGPREPR- 214

  Rat   342 HRQKLDDSKPSLFSDRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFNPQGQSQITDPR----- 401
                   ||     ..||.||:           .|....:....|..|:       |||.     
  Fly   215 -------SK-----TMLSLLGQ-----------QQQFHFAFGQRPFHFS-------TDPLSGFRM 249

  Rat   402 ------QTQSSPPWSYDQSYPSYLSQMTSPSIHS-TTPLSSTRGTGLPAI--------------- 444
                  |:.|:..|.|..:..:|...:.|..:.| |||.|:....  ||:               
  Fly   250 PPIGNCQSASNTHWGYGSAASAYSPYLASSGLSSCTTPTSAQFNN--PALGFTCSSNDQSNNQDF 312

  Rat   445 -----TDVPRRISDSEPSTLDSQSST 465
                 .|....:.||..|.||...|:
  Fly   313 GGATNRDCVPMLPDSTASDLDQHLSS 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Runx2XP_038939882.1 Runt 217..343 CDD:395684 97/125 (78%)
PHA03247 <319..606 CDD:223021 50/179 (28%)
RunxANP_001259747.1 Runt 95..216 CDD:279225 97/128 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3982
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000993
OrthoInspector 1 1.000 - - mtm8944
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.770

Return to query results.
Submit another query.