DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30467 and SAA1

DIOPT Version :10

Sequence 1:NP_611044.1 Gene:CG30467 / 36719 FlyBaseID:FBgn0050467 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_000322.3 Gene:SAA1 / 6288 HGNCID:10513 Length:122 Species:Homo sapiens


Alignment Length:51 Identity:11/51 - (21%)
Similarity:22/51 - (43%) Gaps:3/51 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SNHKESDAYASASASASSASTTPP---PAQEDAEEAELLERMRGDAVGNTM 75
            :|:..||.|..|..:..:|...|.   .|:...:..|.::|..|....:::
Human    45 ANYIGSDKYFHARGNYDAAKRGPGGAWAAEVITDARENIQRFFGHGAEDSL 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30467NP_611044.1 None
SAA1NP_000322.3 Important for amyloid formation, forms amyloid fibrils in vitro 19..45 11/51 (22%)
SAA 22..122 CDD:459744 11/51 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 98..122
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.