DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Khc-73 and CLIP4

DIOPT Version :9

Sequence 1:NP_001261000.1 Gene:Khc-73 / 36718 FlyBaseID:FBgn0019968 Length:1957 Species:Drosophila melanogaster
Sequence 2:NP_001274456.1 Gene:CLIP4 / 79745 HGNCID:26108 Length:705 Species:Homo sapiens


Alignment Length:409 Identity:101/409 - (24%)
Similarity:168/409 - (41%) Gaps:118/409 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1524 NMKHLTGLATLSMSSSTSSG--YGSQAVSCNNLSNEDIASMR-------------SMSIDETPDF 1573
            |..|:||.|.|     ||.|  .|.:.|    ::.:.:.::|             .:.:||.   
Human   268 NYDHVTGKAML-----TSLGLKLGDRVV----IAGQKVGTLRFCGTTEFASGQWAGIELDEP--- 320

  Fly  1574 DRVNSNSPPNRQARVNPFLKDMPK-------AKIQEQPEQQAKKLQEAFTHPLEQLESSQNAQSD 1631
            :..|:.|....|     :.|..||       :||     .:||..::..||......:....:|.
Human   321 EGKNNGSVGKVQ-----YFKCAPKYGIFAPLSKI-----SKAKGRRKNITHTPSTKAAVPLIRSQ 375

  Fly  1632 DDECAQLPKNNNNNLDLVNEPKPLSSQTD--LEESMSQPKSKTEFATDNQN-----GNRSSDELS 1689
            ..:.|.:....|..|        ::|:.|  .|.::|.|..: |..|..:.     |:.||...:
Human   376 KIDVAHVTSKVNTGL--------MTSKKDSASESTLSLPPGE-ELKTVTEKDVALLGSVSSCSST 431

  Fly  1690 HSSEDLLEGDGIVREELPAGKVVRRKKSNTQPPSNGNSINNNNNGTTQAPRINHRASVAKMEGLA 1754
            .|.|.        |:..|       ||.        |:|::|....:::|.::.|||        
Human   432 SSLEH--------RQSYP-------KKQ--------NAISSNKKTMSKSPSLSSRAS-------- 465

  Fly  1755 AYLDSSIMTSSTEVDEESK-DVELVLPEWI-VVGESVLIRPYNTSGVIRFVGTTEFQPGAWIGVE 1817
                :.:.:|:|.....|: :.||.|.|.: |||:.:        |.|||.|||.|.||.|.|:|
Human   466 ----AGLNSSATSTANNSRCEGELRLGERVLVVGQRL--------GTIRFFGTTNFAPGYWYGIE 518

  Fly  1818 LDTPTGKNDGSVKGVQYFQCKPKHGMFVRSDKLM-----LD--------KRGKAMRAYKAAEKSN 1869
            |:.|.|||||||.|||||.|.|::|:|....::.     ||        |:..:...::.:..:.
Human   519 LEKPHGKNDGSVGGVQYFSCSPRYGIFAPPSRVQRVTDSLDTLSEISSNKQNHSYPGFRRSFSTT 583

  Fly  1870 SISKEMSTSMTGSMTRSKS 1888
            |.|.:...:...:.::||:
Human   584 SASSQKEINRRNAFSKSKA 602

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Khc-73NP_001261000.1 KISc_KIF1A_KIF1B 4..359 CDD:276816
KISc 6..359 CDD:214526
Kinesin_assoc 356..468 CDD:292801
FHA 446..546 CDD:238017
KIF1B 741..786 CDD:289208
DUF3694 <1196..1252 CDD:289256
CAP_GLY 1786..1850 CDD:279625 32/63 (51%)
CLIP4NP_001274456.1 ANK 1 65..101
ANK 98..252 CDD:238125
ANK repeat 109..146 CDD:293786
ANK 2 149..180
ANK repeat 153..184 CDD:293786
ANK repeat 186..217 CDD:293786
ANK 3 186..215
CAP_GLY 285..349 CDD:307465 11/75 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 391..410 5/19 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 431..479 15/82 (18%)
CAP_GLY 487..551 CDD:307465 36/71 (51%)
CAP_GLY 626..690 CDD:307465
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0241
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.