DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Khc-73 and ncd

DIOPT Version :9

Sequence 1:NP_001261000.1 Gene:Khc-73 / 36718 FlyBaseID:FBgn0019968 Length:1957 Species:Drosophila melanogaster
Sequence 2:NP_001287592.1 Gene:ncd / 43517 FlyBaseID:FBgn0002924 Length:700 Species:Drosophila melanogaster


Alignment Length:369 Identity:132/369 - (35%)
Similarity:196/369 - (53%) Gaps:45/369 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IKVAVRVRPFNRREIELDTKCIVEMEKQQTI-LQNPPPLEKIERKQPKTFAFDHCFYSLNPEDEN 69
            |:|..|:||....| |....|......:.|: ||:.....|.:..| :.|:||..|:.|      
  Fly   349 IRVFCRIRPPLESE-ENRMCCTWTYHDESTVELQSIDAQAKSKMGQ-QIFSFDQVFHPL------ 405

  Fly    70 FASQETVFDCVGRGILDNAFQGYNACIFAYGQTGSGKSYTMMGTQESKGIIPRLCDQLFSAIANK 134
             :||..:|:.|. .::.:|..|||.||||||||||||:|||.|..||.|:|||..|.||.:|...
  Fly   406 -SSQSDIFEMVS-PLIQSALDGYNICIFAYGQTGSGKTYTMDGVPESVGVIPRTVDLLFDSIRGY 468

  Fly   135 STPELMYKVEVSYMEIYNEKVHDLLDPKPNKQSLKVREHNVMGPYVDGLSQLAVTSYQDIDNLMT 199
            ......|:::.:::|||||.::|||..:.....:::.::|....||..:::..|.....:.:||.
  Fly   469 RNLGWEYEIKATFLEIYNEVLYDLLSNEQKDMEIRMAKNNKNDIYVSNITEETVLDPNHLRHLMH 533

  Fly   200 EGNKSRTVAATNMNAESSRSHAVFSVVLTQILTDQATGVSGEK----VSRMSLVDLAGSERAVKT 260
            ....:|..|:|..|..|||||||..:.|        .|...||    |..::|||||||| :.||
  Fly   534 TAKMNRATASTAGNERSSRSHAVTKLEL--------IGRHAEKQEISVGSINLVDLAGSE-SPKT 589

  Fly   261 GAVGDRLKEGSNINKSLTTLGLVISKLADQSNGKKSGNDKFVPYRDSVLTWLLKDNLGGNSRTVM 325
            ..   |:.|..|||:||:.|..||..|..:.:        .:|||:|.||.||..:|||||:|:|
  Fly   590 ST---RMTETKNINRSLSELTNVILALLQKQD--------HIPYRNSKLTHLLMPSLGGNSKTLM 643

  Fly   326 VATISPSADNYEETLSTLRYA--------DRAK--RIVNHAVVN 359
            ...:||..|.::|::.:||:|        .:||  |.:|::|.|
  Fly   644 FINVSPFQDCFQESVKSLRFAASVNSCKMTKAKRNRYLNNSVAN 687

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Khc-73NP_001261000.1 KISc_KIF1A_KIF1B 4..359 CDD:276816 131/367 (36%)
KISc 6..359 CDD:214526 131/367 (36%)
Kinesin_assoc 356..468 CDD:292801 2/4 (50%)
FHA 446..546 CDD:238017
KIF1B 741..786 CDD:289208
DUF3694 <1196..1252 CDD:289256
CAP_GLY 1786..1850 CDD:279625
ncdNP_001287592.1 KISc_C_terminal 346..672 CDD:276817 126/352 (36%)
KISc 348..678 CDD:214526 128/358 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437754
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.