DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Khc-73 and Klp59D

DIOPT Version :9

Sequence 1:NP_001261000.1 Gene:Khc-73 / 36718 FlyBaseID:FBgn0019968 Length:1957 Species:Drosophila melanogaster
Sequence 2:NP_611762.1 Gene:Klp59D / 37674 FlyBaseID:FBgn0034827 Length:729 Species:Drosophila melanogaster


Alignment Length:474 Identity:156/474 - (32%)
Similarity:221/474 - (46%) Gaps:85/474 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KIKVAVRVRPFNRREIELDTKCIVEMEKQQTILQNPPPLEKIERKQPKT-------FAFDHCFYS 62
            :|.|.||.||.:|:|.......|:.:....:::     :.::..|...|       |.||:.|  
  Fly   233 QITVCVRKRPMSRKEENSKNLDIITVPSADSLI-----VHELRLKVDLTKFLEHHKFRFDYTF-- 290

  Fly    63 LNPEDENFASQETVFDCVGRGILDNAFQGYNACIFAYGQTGSGKSYTMMGTQESK------GIIP 121
                ||. .|...|:|...|.::...|:|.||..||||||||||::||.|....|      ||..
  Fly   291 ----DEE-CSNALVYDHTARPLIRTMFEGGNATCFAYGQTGSGKTHTMGGEFFGKVQDCGTGIYA 350

  Fly   122 RLCDQLFSAIANKSTPELMYKVEVSYMEIYNEKVHDLLDPKPNKQSLKVREHNVMGPYVDGLSQL 186
            .....:|..::.....::..|:..|:.|||..||.|||  .|||..|:|.|.......|.||:::
  Fly   351 MAARDVFEEVSRPEYRQMGAKITCSFFEIYGTKVFDLL--LPNKPMLRVLEDARQQVVVVGLTEM 413

  Fly   187 AVTSYQDIDNLMTEGNKSRTVAATNMNAESSRSHAVFSVVLTQILTDQATGVSGEKVSRMSLVDL 251
            .||..:|:..|:..|:|.||...|:.||:||||||||.:.|.   ...:.|..|    :.|.|||
  Fly   414 PVTKVEDVLRLIEHGSKERTSGQTSANAKSSRSHAVFQIALH---FPDSWGPHG----KCSFVDL 471

  Fly   252 AGSERAVKTGAVGDRLK-EGSNINKSLTTLGLVISKLADQSNGKKSGNDKFVPYRDSVLTWLLKD 315
            ||:||...|.:...:.: ||:.|||||..|...|..|:.||:        .:|:|.|.||.:|:|
  Fly   472 AGNERGADTQSADRQTRIEGAEINKSLLALKECIRALSRQSS--------HLPFRGSKLTQVLRD 528

  Fly   316 NL--GGNSRTVMVATISPSADNYEETLSTLRYADRAKRIVNHAVVNEDPNARIIRELRHEVETLR 378
            :.  |..::|.|:|.||||....|.||:|||||||.|.:    :..||             |.|:
  Fly   529 SFVGGKKNKTCMIAMISPSMSCVENTLNTLRYADRVKEL----IAKED-------------EHLQ 576

  Fly   379 SMLKHATGSPVGDVQDKLAESENLMKQISQTWEEKLVKTERIQNERQQALEKMGISVQASGIKVE 443
            |:......||     |...|||..|....:..||.       ::|..|.|.   ||.:      |
  Fly   577 SVEGDGEKSP-----DLNEESEPEMMADEEGDEEP-------EDEDNQHLT---ISSE------E 620

  Fly   444 KNKYYLVNLNADPSLNELL 462
            .:.|.  |::.|.|.|..|
  Fly   621 ASSYN--NMSYDMSFNHTL 637

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Khc-73NP_001261000.1 KISc_KIF1A_KIF1B 4..359 CDD:276816 130/369 (35%)
KISc 6..359 CDD:214526 130/368 (35%)
Kinesin_assoc 356..468 CDD:292801 26/107 (24%)
FHA 446..546 CDD:238017 6/17 (35%)
KIF1B 741..786 CDD:289208
DUF3694 <1196..1252 CDD:289256
CAP_GLY 1786..1850 CDD:279625
Klp59DNP_611762.1 KISc_KIF2_like 233..565 CDD:276818 129/360 (36%)
Kinesin 239..566 CDD:278646 126/355 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437741
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24115
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.