DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Khc-73 and Klp59C

DIOPT Version :9

Sequence 1:NP_001261000.1 Gene:Khc-73 / 36718 FlyBaseID:FBgn0019968 Length:1957 Species:Drosophila melanogaster
Sequence 2:NP_611759.1 Gene:Klp59C / 37671 FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster


Alignment Length:459 Identity:147/459 - (32%)
Similarity:231/459 - (50%) Gaps:47/459 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KIKVAVRVRPFNRREIELDTKCIVEMEKQQTILQNPP--PLEKIERKQPKTFAFDHCFYSLNPED 67
            :|.|.||.||..|:|:....:.:|.:..:.|::.:.|  .:..::..:..:|.||:.|      |
  Fly   187 QIMVCVRKRPLRRKELADREQDVVSIPSKHTLVVHEPRKHVNLVKFLENHSFRFDYVF------D 245

  Fly    68 ENFASQETVFDCVGRGILDNAFQGYNACIFAYGQTGSGKSYTMMGT-----QES-KGIIPRLCDQ 126
            |. .|..||::...|.::.:.|.|..|..||||||||||:|||.|.     |.| .||.......
  Fly   246 EE-CSNATVYEFTARPLIKHIFDGGMATCFAYGQTGSGKTYTMGGQFPGRHQSSMDGIYAMAAKD 309

  Fly   127 LFSAIANKSTPELMYKVEVSYMEIYNEKVHDLLDPKPNKQSLKVREHNVMGPYVDGLSQLAVTSY 191
            :||.:......:|..||..|:.|||..:|.|||  .|.|..|:|.|.......|.||:|..|.:.
  Fly   310 VFSTLKTVPYNKLNLKVYCSFFEIYGTRVFDLL--MPGKPQLRVLEDRNQQVQVVGLTQNPVQNT 372

  Fly   192 QDIDNLMTEGNKSRTVAATNMNAESSRSHAVFSVVLTQILTDQATGVSGEKV-SRMSLVDLAGSE 255
            .::.:|:..||..||...|:.|::||||||||.:||        ...:|||: .:.||:||||:|
  Fly   373 AEVLDLLELGNSVRTSGHTSANSKSSRSHAVFQIVL--------RSAAGEKLHGKFSLIDLAGNE 429

  Fly   256 RAVKTGAVGDRLK-EGSNINKSLTTLGLVISKLADQSNGKKSGNDKFVPYRDSVLTWLLKDN-LG 318
            |.....:...:.: |||.|||||..|...|..|..||:        .:|:|.|.||.:|:|: :|
  Fly   430 RGADNSSADRQTRLEGSEINKSLLVLKECIRALGRQSS--------HLPFRGSKLTQVLRDSFIG 486

  Fly   319 GNS-RTVMVATISPSADNYEETLSTLRYADRAKRIVNHAVVNED-PNARI----IRELRHEVETL 377
            |.. :|.|:|.|||...:.|.||:|||||||.|.:...::.::. |:|.:    :.::..:..|.
  Fly   487 GKKVKTCMIAMISPCLHSVEHTLNTLRYADRVKELSVESIPSKRMPDANLGSTSMSDIVCQSSTQ 551

  Fly   378 RSM-LKHATGSPVGDVQDKLAESENLMKQISQTWEEKLVKTERIQNERQQALEKMGISVQASGIK 441
            |.. ...:|..|.|..|.:  :..|....::::  :|...........||.:::.|.|.:.:.:.
  Fly   552 RLFPCASSTSMPGGGNQAQ--QHTNTANDLNRS--QKPTSKPTYPTSGQQLVQRKGSSQREASMM 612

  Fly   442 VEKN 445
            :.|:
  Fly   613 LTKS 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Khc-73NP_001261000.1 KISc_KIF1A_KIF1B 4..359 CDD:276816 132/365 (36%)
KISc 6..359 CDD:214526 132/364 (36%)
Kinesin_assoc 356..468 CDD:292801 15/96 (16%)
FHA 446..546 CDD:238017 147/459 (32%)
KIF1B 741..786 CDD:289208
DUF3694 <1196..1252 CDD:289256
CAP_GLY 1786..1850 CDD:279625
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 131/356 (37%)
Kinesin 193..520 CDD:278646 128/351 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437742
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24115
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.