DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant1 and galnt2

DIOPT Version :9

Sequence 1:NP_611043.1 Gene:Pgant1 / 36717 FlyBaseID:FBgn0034025 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_009305623.1 Gene:galnt2 / 570248 ZFINID:ZDB-GENE-041111-110 Length:565 Species:Danio rerio


Alignment Length:564 Identity:210/564 - (37%)
Similarity:304/564 - (53%) Gaps:59/564 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GHGRERFEAYSDSENEIARPATQSPYEQIIQLDLQKQKVGLG-------EQGVAVHLSGAAKER- 106
            |....|.:.:|:::::                |...:.:.||       :|.:.|   ||...| 
Zfish    37 GINSNRIQTHSNADDK----------------DHSLESLPLGKVRWQDYDQDLYV---GATVVRP 82

  Fly   107 GDEIYKKIALNEELSEQLTYNRSVGDHRNPLCAKQRFDSDSLPTASVVIIFFNEPYSVLLRTVHS 171
            |.:.|.:...|:..|::|..:|::.|.|:..|..:::.:| ||.:||||.|.||..|.|||||.|
Zfish    83 GQDPYARNKFNQVESDKLRMDRNIPDTRHDHCRHKQWRTD-LPASSVVITFHNEARSALLRTVIS 146

  Fly   172 TLSTCNEKALKEIILVDDGSDNVELGAKLDYYVRTRIPSGKVTILRLKNRLGLIRARLAGARIAT 236
            .|.......:||||||||.|||.|.||.|.     :|.  ||.:||...|.||:|:|:.||..||
Zfish   147 VLKKSPPHLVKEIILVDDYSDNPEDGALLG-----KIE--KVRVLRNDRREGLMRSRVRGADAAT 204

  Fly   237 GDVLIFLDAHCEGNIGWCEPLLQRIKESRTSVLVPIIDVIDANDFQYSTNGYKSFQVGGFQWNGH 301
            ..||.|||:|||.|..|.||||:|:.|.:|.|:.||||||:.::|||.  |..:...|||.||..
Zfish   205 ASVLTFLDSHCECNEHWLEPLLERVAEDKTRVVSPIIDVINMDNFQYV--GASADLKGGFDWNLV 267

  Fly   302 FDWINLPEREKQRQRRECKQEREICPAYSPTMAGGLFAIDRRYFWEVGSYDEQMDGWGGENLEMS 366
            |.|..:     ..::|..:|...|.|..:|.:|||||.:|:.||.|:|.||..||.|||||||:|
Zfish   268 FKWDYM-----TLEQRRARQGNPIAPIKTPMIAGGLFVMDKDYFEELGKYDMMMDVWGGENLEIS 327

  Fly   367 FRIWQCGGTIETIPCSRVGHIFRDFHPYKFPNDRDT-HGINTARMALVWMDEYINIFFLNRPDLK 430
            ||:|||||::|.||||||||:||..|||.||....| ...||.|.|.||||::.|.::...|..:
Zfish   328 FRVWQCGGSLEIIPCSRVGHVFRKQHPYTFPGGSGTVFARNTRRAAEVWMDDFKNFYYAAVPSAR 392

  Fly   431 FHADIGDVTHRVMLRKKLRCKSFEWYLKNIYPEKFVPTKDVQGWGKVHAVNSNICLDDLLQNNEK 495
             :...|::..|:.::|:|.||.|:|||:|:|||..||......:|.:.  ....|||.|  .:..
Zfish   393 -NVPYGNIQSRLEMKKRLGCKPFKWYLENVYPELRVPDHQDIAFGALQ--QGQNCLDTL--GHFA 452

  Fly   496 PYNAGLYPC-----GKVLQKSQLFSFTNTNVLRNELSCATVQHSESPPYRVVMVPCMENDEFNEQ 555
            ....|:|.|     .:|..|:|.::.|....:::...|.||. ..:...::.:..|.|||. .::
Zfish   453 DGVVGVYECHNAGGNQVSNKTQEWALTKDKSVKHMDLCLTVV-DRTAGSQIKLQGCRENDT-RQK 515

  Fly   556 WRY--EHQHIIHSNTGMCLDHQGLKSLDDAQVAPCDPHSESQRW 597
            |..  .:..:.|..:.:|||.:..:| ....|..|.| |.:|:|
Zfish   516 WEQIDNNTKLRHVGSNLCLDSRSARS-GGLTVEVCSP-SLTQQW 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant1NP_611043.1 WcaA 147..426 CDD:223539 141/279 (51%)
pp-GalNAc-T 152..461 CDD:133004 151/309 (49%)
Ricin_B_lectin 474..597 CDD:279046 30/129 (23%)
RICIN 481..599 CDD:238092 30/124 (24%)
galnt2XP_009305623.1 pp-GalNAc-T 127..422 CDD:133004 151/309 (49%)
Glyco_tranf_2_3 127..351 CDD:290369 123/237 (52%)
Ricin_B_lectin 434..557 CDD:279046 30/130 (23%)
RICIN 444..559 CDD:238092 30/120 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.