DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant1 and GALNT9

DIOPT Version :9

Sequence 1:NP_611043.1 Gene:Pgant1 / 36717 FlyBaseID:FBgn0034025 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001116108.1 Gene:GALNT9 / 50614 HGNCID:4131 Length:603 Species:Homo sapiens


Alignment Length:653 Identity:219/653 - (33%)
Similarity:318/653 - (48%) Gaps:134/653 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LIIFILVALCFILYSKVQQNGSPEEPPVAPLVRAAALRGHGRERFEAYSDSENEIARPATQSPYE 76
            :::|:.:.| |.:|.::|  |..:|     |||..:  |..|.|        :..|:..|....|
Human    15 ILVFVGIVL-FSVYCRLQ--GRSQE-----LVRIVS--GDRRVR--------SRHAKVGTLGDRE 61

  Fly    77 QIIQ-LDLQKQKV------------------GLGEQGVAVHLSGAAKERGDEI---YKKIALNEE 119
            .|:| ||..::.|                  |||:.|:|..|    ::.|.|.   |::...|.:
Human    62 AILQRLDHLEEVVYNQLNGLAKPIGLVEGPGGLGQGGLAATL----RDDGQEAEGKYEEYGYNAQ 122

  Fly   120 LSEQLTYNRSVGDHRNPLCAKQRFDSDSLPTASVVIIFFNEPYSVLLRTVHSTLSTCNEKALKEI 184
            ||::::.:||:.|:|...|.:..:..| ||..|||.||.||..||:||:|||.::....:.|||:
Human   123 LSDRISLDRSIPDYRPRKCRQMSYAQD-LPQVSVVFIFVNEALSVILRSVHSVVNHTPSQLLKEV 186

  Fly   185 ILVDDGSDNVELGAKLDYYVRTRIPSGKVTILRLKNRLGLIRARLAGARIATGDVLIFLDAHCEG 249
            |||||.||||||...||.||..|.| |.|.|:|...|.|||||||.|.:.||..|:.|.|||.|.
Human   187 ILVDDNSDNVELKFNLDQYVNKRYP-GLVKIVRNSRREGLIRARLQGWKAATAPVVGFFDAHVEF 250

  Fly   250 NIGWCEPLLQRIKESRTSVLVPIIDVIDANDF---QYSTNGYKSFQVGGFQWNGHF--------D 303
            |.||.||.|.||:|.|..:::|.||.|..:.|   ||:...:      |:.| |.:        |
Human   251 NTGWAEPALSRIREDRRRIVLPAIDNIKYSTFEVQQYANAAH------GYNW-GLWCMYIIPPQD 308

  Fly   304 WINLPEREKQRQRRECKQEREICPAYSPTMAGGLFAIDRRYFWEVGSYDEQMDGWGGENLEMSFR 368
            |::..:              |..|..:|.|.|..|.:||.||.::|..|..|:.:||||:|:..|
Human   309 WLDRGD--------------ESAPIRTPAMIGCSFVVDREYFGDIGLLDPGMEVYGGENVELGMR 359

  Fly   369 IWQCGGTIETIPCSRVGHIFRDFHPYKFPNDRDTHG-INTARMALVWMDEYINIFFL--NRPDLK 430
            :|||||::|.:|||||.||.|...||.  ||.|.:. .|..|.|.||||::.:..::  |.|...
Human   360 VWQCGGSMEVLPCSRVAHIERTRKPYN--NDIDYYAKRNALRAAEVWMDDFKSHVYMAWNIPMSN 422

  Fly   431 FHADIGDVTHRVMLRKKLRCKSFEWYLKNIYPEKFVPTKDVQGWGKV-HAVNSNICLDDLLQNNE 494
            ...|.|||:.|:.||::|:|:||:|||:|:|||..|....:. :|:| ::..|..|||   |..|
Human   423 PGVDFGDVSERLALRQRLKCRSFKWYLENVYPEMRVYNNTLT-YGEVRNSKASAYCLD---QGAE 483

  Fly   495 KPYNAGLYPCGKVLQKSQLFSFTNTNVLRNELSCATVQHSESPPYRVVMVP---CMENDEFNEQ- 555
            ....|.||||..:  .|||..::...:|:           ..|......:|   |:.:|..... 
Human   484 DGDRAILYPCHGM--SSQLVRYSADGLLQ-----------LGPLGSTAFLPDSKCLVDDGTGRMP 535

  Fly   556 ---------------WRY-EHQHIIHSNTGMCLDHQGLKSLDDAQ------VAPCDPHSESQRWT 598
                           |.: :...|:...||.||:.:..|   ||.      |..|    ..|:|.
Human   536 TLKKCEDVARPTQRLWDFTQSGPIVSRATGRCLEVEMSK---DANFGLRLVVQRC----SGQKWM 593

  Fly   599 IEH 601
            |.:
Human   594 IRN 596

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant1NP_611043.1 WcaA 147..426 CDD:223539 124/292 (42%)
pp-GalNAc-T 152..461 CDD:133004 139/322 (43%)
Ricin_B_lectin 474..597 CDD:279046 33/149 (22%)
RICIN 481..599 CDD:238092 32/143 (22%)
GALNT9NP_001116108.1 Catalytic subdomain A 150..261 63/111 (57%)
pp-GalNAc-T 154..453 CDD:133004 139/322 (43%)
Catalytic subdomain B 318..380 31/61 (51%)
Ricin_B_lectin 464..592 CDD:279046 33/151 (22%)
RICIN 466..594 CDD:238092 34/150 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.