DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant1 and Galntl5

DIOPT Version :9

Sequence 1:NP_611043.1 Gene:Pgant1 / 36717 FlyBaseID:FBgn0034025 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001020319.1 Gene:Galntl5 / 499968 RGDID:1565271 Length:443 Species:Rattus norvegicus


Alignment Length:351 Identity:158/351 - (45%)
Similarity:213/351 - (60%) Gaps:14/351 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 KIALNEELSEQLTYNRSVGDHRNPLCAKQRFDSDSLPTASVVIIFFNEPYSVLLRTVHSTLSTCN 177
            :..||...|.:|...|.|.|.||.:|.::.:.. :||||||:|.|:||.::.|||||.|.::...
  Rat    85 RYGLNVITSRRLGIERQVPDSRNKICQQKHYPF-NLPTASVIICFYNEEFNTLLRTVSSVMNLSP 148

  Fly   178 EKALKEIILVDDGSDNVELGAKLDYYVRTRIPSGKVTILRLKNRLGLIRARLAGARIATGDVLIF 242
            :..|:|||||||.|:..:|.|||||::  .|..||:.::|.|.|.||||:|:.||..|:||:|:|
  Rat   149 KHLLEEIILVDDMSEFDDLKAKLDYHL--EIFRGKIKLVRNKKREGLIRSRMIGASRASGDILVF 211

  Fly   243 LDAHCEGNIGWCEPLLQRIKESRTSVLVPIIDVIDANDFQYSTNGYKSFQVGGFQWNGHFDWINL 307
            ||:|||.|..|.||||..|.:....|:.|:|||||.....|..:   ....|.|.||.:|.|.::
  Rat   212 LDSHCEVNRVWLEPLLHAIAKDHKMVVCPVIDVIDELTLDYVGS---PIVRGAFDWNLNFRWDDV 273

  Fly   308 PEREKQRQRRECKQEREICPAYSPTMAGGLFAIDRRYFWEVGSYDEQMDGWGGENLEMSFRIWQC 372
            ...|..      ..|....|..||.|:||:|||:|.||.|:|.||:.||.|||||:|:|.|||.|
  Rat   274 FSYELD------GPEGPSTPIRSPAMSGGIFAINRHYFNELGQYDKDMDLWGGENVELSLRIWMC 332

  Fly   373 GGTIETIPCSRVGHIFRDFHPYKFPNDRDTHGINTARMALVWMDEYINIFFLNRPDLKFHADIGD 437
            ||.:..:|||||||..:.....:..| :.....|..|:..||:|||...|||.||.|. |...|:
  Rat   333 GGQLFILPCSRVGHNNKALSKNRLVN-QSALSKNLLRVVHVWLDEYKENFFLQRPSLT-HVSCGN 395

  Fly   438 VTHRVMLRKKLRCKSFEWYLKNIYPE 463
            ::.||.|||:|.||||:|||.||:||
  Rat   396 ISDRVELRKRLGCKSFQWYLDNIFPE 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant1NP_611043.1 WcaA 147..426 CDD:223539 126/278 (45%)
pp-GalNAc-T 152..461 CDD:133004 141/308 (46%)
Ricin_B_lectin 474..597 CDD:279046
RICIN 481..599 CDD:238092
Galntl5NP_001020319.1 pp-GalNAc-T 123..419 CDD:133004 141/308 (46%)
Glyco_tranf_2_3 123..355 CDD:290369 111/242 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.