DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant1 and CG10000

DIOPT Version :9

Sequence 1:NP_611043.1 Gene:Pgant1 / 36717 FlyBaseID:FBgn0034025 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_651630.3 Gene:CG10000 / 43394 FlyBaseID:FBgn0039596 Length:558 Species:Drosophila melanogaster


Alignment Length:633 Identity:194/633 - (30%)
Similarity:293/633 - (46%) Gaps:136/633 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PRFRSFYGKLIIFILVALCFILYSKVQQNGSPEEPPVAPLVRAAALRGHGRERFEAYSDSENEIA 67
            ||..|||  :|.|::..|.|::......:.|                            |.||:.
  Fly    10 PRHCSFY--IIAFLICQLFFLVIFIRNDDAS----------------------------SANELL 44

  Fly    68 RPATQSPYEQIIQLDLQKQKVGLGEQGVAVHLSGAAKERGDEIYKKIALNEELSEQLTYNRSVGD 132
            ....:|  |:...||.:            |.:| ...|..::.|:   .|..||..|...|.:..
  Fly    45 SFMNES--EESDHLDWR------------VFIS-HTPETSEDFYQ---YNIHLSNALGLIRKLPV 91

  Fly   133 HRNPLCAKQRFDSDSLP-----TASVVIIFFNEPYSVLLRTVHSTLSTCNEKALKEIILVDDGSD 192
            .|:..|..:   :..||     ..||||.|.||..|:||||:.|.||...|..|.|:|||||||.
  Fly    92 TRHHSCTTR---NSILPAPLEANVSVVISFHNEARSMLLRTIVSLLSRSPEDYLHELILVDDGSQ 153

  Fly   193 -NVELGAKLDYYVR-------TRIPSGKVTILRLKNRLGLIRARLAGARIATGDVLIFLDAHCEG 249
             :|.|   ||...|       :|...| :|.||.:.|:|||.:|..||.:|:|..::|||:|||.
  Fly   154 RDVTL---LDDLKRWMGGVFGSRYRLG-LTFLRNQERMGLIWSRNRGASLASGRYVLFLDSHCEV 214

  Fly   250 NIGWCEPLLQRIKESRTSVLVPIIDVIDANDFQYSTNGYKSFQVGGFQWNGHFDWINLPEREKQR 314
            |.||.||||:|:..:....:.|::|.||.....|...  .....|||.|:.||.|:         
  Fly   215 NEGWLEPLLERLALNTNLAVSPLLDPIDPTTLSYRKG--NELLKGGFDWSLHFHWL--------- 268

  Fly   315 QRRECKQEREICPAYSPTMAGGLFAIDRRYFWEVGSYDEQMDGWGGENLEMSFRIWQCGGTIETI 379
            :|:...||....|..||..|||:..:.|.:|.::||::..:..||||::|::.::|.|||.||.:
  Fly   269 KRQLTNQESLEMPYQSPAFAGGVLMMSREWFLKLGSFNPYLKIWGGESIELAIKLWLCGGQIEIV 333

  Fly   380 PCSRVGHIFRDFHPYKFP--NDR------DTHGINTARMALVWMDEYINIFFLNRPDLKFHADIG 436
            ||||:|||||..|.:.||  :||      :|:..|:..:|..|:|||.|:|:..||         
  Fly   334 PCSRIGHIFRRRHAFDFPPQSDRQLSPAQETYLHNSKIIAESWLDEYKNMFYALRP--------- 389

  Fly   437 DVTHRVML----------RKKLRCKSFEWYLKNIYPEKFVPTKDVQGWGKVHAVNSNICLDDLLQ 491
             ...|:.|          ||:.||..|||||:::.||..:...::...|.:.  |.:.|: ...|
  Fly   390 -AARRIPLDHTYDELQRMRKERRCHPFEWYLRHVSPELRMHFDELSATGTLR--NEDRCV-HARQ 450

  Fly   492 NNEKPYNAGLYPCGKVLQKSQLFSFTNTNVLR--NELS-----CATVQHSESPPYRVVMVPCMEN 549
            .:.:|..|..|          |...|..::||  .:||     |..|...    .|:.:.||..|
  Fly   451 KDSQPILASCY----------LSDITQWSMLRQSGQLSTHRELCLAVGFG----MRIALEPCGRN 501

  Fly   550 DEF--NEQWRYEHQHIIHSNTGMCLDHQGLKSLDDAQVAPCDPHSESQ 595
            :..  :::|.....|::|:.:.:|||:. ||  |..:::.|..|:.||
  Fly   502 ETVRRSQRWVRLGTHLLHAESHLCLDNP-LK--DRLEMSTCRSHAVSQ 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant1NP_611043.1 WcaA 147..426 CDD:223539 119/299 (40%)
pp-GalNAc-T 152..461 CDD:133004 130/334 (39%)
Ricin_B_lectin 474..597 CDD:279046 32/131 (24%)
RICIN 481..599 CDD:238092 31/124 (25%)
CG10000NP_651630.3 pp-GalNAc-T 113..422 CDD:133004 130/333 (39%)
Ricin_B_lectin 435..548 CDD:279046 32/132 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11675
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.