DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant1 and GALNT18

DIOPT Version :9

Sequence 1:NP_611043.1 Gene:Pgant1 / 36717 FlyBaseID:FBgn0034025 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_940918.2 Gene:GALNT18 / 374378 HGNCID:30488 Length:607 Species:Homo sapiens


Alignment Length:628 Identity:194/628 - (30%)
Similarity:293/628 - (46%) Gaps:84/628 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LVALCFIL------------------YSKVQQNGSPEEPPVAPLVRAAALRGHGRERFEAYSDSE 63
            ||:.|.||                  .:.|...|  :||  ||..:....:|...:..|.....|
Human    10 LVSTCVILSGMTNIICLLYVGWVTNYIASVYVRG--QEP--APDKKLEEDKGDTLKIIERLDHLE 70

  Fly    64 NEIARPATQSPYEQIIQLDLQKQKVGLGEQGVAVHLSGAAKERGDEIYKKIAL--------NEEL 120
            |.|.:...::|.:     ..:.:.....:..:..|........|    :::||        |..|
Human    71 NVIKQHIQEAPAK-----PEEAEAEPFTDSSLFAHWGQELSPEG----RRVALKQFQYYGYNAYL 126

  Fly   121 SEQLTYNRSVGDHRNPLCAKQRFDSDSLPTASVVIIFFNEPYSVLLRTVHSTLSTCNEKALKEII 185
            |::|..:|.:.|.|...|....| .||||..|:|.||.||..|||||::||.:.......|||||
Human   127 SDRLPLDRPLPDLRPSGCRNLSF-PDSLPEVSIVFIFVNEALSVLLRSIHSAMERTPPHLLKEII 190

  Fly   186 LVDDGSDNVELGAKLDYYVRTRIPS---GKVTILRLKNRLGLIRARLAGARIATGDVLIFLDAHC 247
            ||||.|.|.||..||..|| .::.|   |.:.::|...:.||||:|::|.|.||..|:...|||.
Human   191 LVDDNSSNEELKEKLTEYV-DKVNSQKPGFIKVVRHSKQEGLIRSRVSGWRAATAPVVALFDAHV 254

  Fly   248 EGNIGWCEPLLQRIKESRTSVLVPIIDVIDANDFQYSTNGYKSFQVGGFQWNGHFDWINLPEREK 312
            |.|:||.||:|.||||:|..::.|..|.|..::|:...   ......||.|.....::|.|    
Human   255 EFNVGWAEPVLTRIKENRKRIISPSFDNIKYDNFEIEE---YPLAAQGFDWELWCRYLNPP---- 312

  Fly   313 QRQRRECKQEREICPAYSPTMAGGLFAIDRRYFWEVGSYDEQMDGWGGENLEMSFRIWQCGGTIE 377
               :...|.|....|..||.:. |.|.:||:||.|:|..||.|:.:||||:|:..|:|||||::|
Human   313 ---KAWWKLENSTAPIRSPALI-GCFIVDRQYFQEIGLLDEGMEVYGGENVELGIRVWQCGGSVE 373

  Fly   378 TIPCSRVGHIFRDFHPYKFPNDRDTH-GINTARMALVWMDEYINIFFL--NRPDLKFHADIGDVT 439
            .:||||:.||.|...||  ..|...| ..|..|:|.|||||:.:..::  |.|......||||:|
Human   374 VLPCSRIAHIERAHKPY--TEDLTAHVRRNALRVAEVWMDEFKSHVYMAWNIPQEDSGIDIGDIT 436

  Fly   440 HRVMLRKKLRCKSFEWYLKNIYPEKFVPTKDVQGWGKV-HAVNSNICLDDLLQNNEKPYNAGLYP 503
            .|..|||:|:||:|.|||.::|||..: ..|:..:|.: :::.:::|||........|.   :|.
Human   437 ARKALRKQLQCKTFRWYLVSVYPEMRM-YSDIIAYGVLQNSLKTDLCLDQGPDTENVPI---MYI 497

  Fly   504 CGKVLQKSQLFSFTNTNVLRNELSCATVQHSE--------SPPYRVVMVPCMENDEFNEQWRYEH 560
            |..:  ..|...:|::..:...:...||...:        |.| |::.....:.......|::..
Human   498 CHGM--TPQNVYYTSSQQIHVGILSPTVDDDDNRCLVDVNSRP-RLIECSYAKAKRMKLHWQFSQ 559

  Fly   561 QHIIHS-NTGMCLDHQGLKSLD---DAQVAPCDPHSESQRWTI 599
            ...|.: .:..||:.|....|:   ...:..|    ..|.|:|
Human   560 GGPIQNRKSKRCLELQENSDLEFGFQLVLQKC----SGQHWSI 598

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant1NP_611043.1 WcaA 147..426 CDD:223539 117/284 (41%)
pp-GalNAc-T 152..461 CDD:133004 132/314 (42%)
Ricin_B_lectin 474..597 CDD:279046 22/135 (16%)
RICIN 481..599 CDD:238092 22/129 (17%)
GALNT18NP_940918.2 Catalytic subdomain A 153..267 55/114 (48%)
pp-GalNAc-T 157..458 CDD:133004 132/314 (42%)
Catalytic subdomain B 324..385 32/61 (52%)
RICIN 471..598 CDD:238092 23/136 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.