DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant1 and GALNT8

DIOPT Version :9

Sequence 1:NP_611043.1 Gene:Pgant1 / 36717 FlyBaseID:FBgn0034025 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_059113.1 Gene:GALNT8 / 26290 HGNCID:4130 Length:637 Species:Homo sapiens


Alignment Length:587 Identity:191/587 - (32%)
Similarity:290/587 - (49%) Gaps:94/587 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 RERFEAYSDSENEIARPATQS---PYEQIIQLDLQKQKVGLGEQGVAVHLSGAAKERGDEIYKKI 114
            |...:|.....||..:..||.   |:.|:.:        ..||.     ||.|.::...::::|.
Human    96 RPLLKAMETKVNETKKHKTQMKLFPHSQLFR--------QWGED-----LSEAQQKAAQDLFRKF 147

  Fly   115 ALNEELSEQLTYNRSVGDHRNPLCAKQRFDSDSLPTASVVIIFFNEPYSVLLRTVHSTLSTCNEK 179
            ..|..||.||..||::.|.|:..|.::.:.| .||:.||::||.||..|::.|.:.|.::....:
Human   148 GYNAYLSNQLPLNRTIPDTRDYRCLRKTYPS-QLPSLSVILIFVNEALSIIQRAITSIINRTPSR 211

  Fly   180 ALKEIILVDDGSDNVELGAKLDYYVR---TRIPSGKVTILRLKNRLGLIRARLAGARIATGDVLI 241
            .|||||||||.|.|.||...||..::   .:.| |.:.|:|...|.||.:||..|...||.||:.
Human   212 LLKEIILVDDFSSNGELKVHLDEKIKLYNQKYP-GLLKIIRHPERKGLAQARNTGWEAATADVVA 275

  Fly   242 FLDAHCEGNIGWCEPLLQRIKESRTSVLVPIIDVIDANDFQYSTNGYKSFQVGGFQWN--GHFD- 303
            .||||.|.|:||.||:|.||:|.||.::.|:.|.|..:.|:  .:.|: ..|.||.|.  ..:| 
Human   276 ILDAHIEVNVGWAEPILARIQEDRTVIVSPVFDNIRFDTFK--LDKYE-LAVDGFNWELWCRYDA 337

  Fly   304 ----WINLPEREKQRQRRECKQEREICPAYSPTMAGGLFAIDRRYFWEVGSYDEQMDGWGGENLE 364
                ||:|.:              ...|..||::. |:.|.:|.:..|:||.|..|..:||||:|
Human   338 LPQAWIDLHD--------------VTAPVKSPSIM-GILAANRHFLGEIGSLDGGMLIYGGENVE 387

  Fly   365 MSFRIWQCGGTIETIPCSRVGHIFRDFHPYKFPNDRDTHGI--NTARMALVWMDEYINIFFL--N 425
            :|.|:|||||.:|.:||||:.|:.|...||....   |..:  |..|:|.:||||:.::.:|  |
Human   388 LSLRVWQCGGKVEILPCSRIAHLERHHKPYALDL---TAALKRNALRVAEIWMDEHKHMVYLAWN 449

  Fly   426 RPDLKFHADIGDVTHRVMLRKKLRCKSFEWYLKNIYPEKFVPTKDVQGWGKV-HAVNSNICLDDL 489
            .|......|.|||:.|:.||:||:||:|:|||||:|| ...|...:.|:|:: :.::.|:|||  
Human   450 IPLQNSGIDFGDVSSRMALREKLKCKTFDWYLKNVYP-LLKPLHTIVGYGRMKNLLDENVCLD-- 511

  Fly   490 LQNNEKPYNAG-LYPCGKVLQKSQLFSFTNTNV---LRNEL-------------SCATVQHSESP 537
              ....|.|.. :|.|         ..|::.||   |..||             .|.|.......
Human   512 --QGPVPGNTPIMYYC---------HEFSSQNVYYHLTGELYVGQLIAEASASDRCLTDPGKAEK 565

  Fly   538 PYRVVMVPCME--NDEFNEQWRYE-HQHIIHSNTGMCLDHQGLKSLDDAQVAPCDPHSESQRWTI 599
            |   .:.||.:  .:..:..|.:: ...:|:.:|..||:.:  |.|..:.|......| :|.|.|
Human   566 P---TLEPCSKAAKNRLHIYWDFKPGGAVINRDTKRCLEMK--KDLLGSHVLVLQTCS-TQVWEI 624

  Fly   600 EH 601
            :|
Human   625 QH 626

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant1NP_611043.1 WcaA 147..426 CDD:223539 110/292 (38%)
pp-GalNAc-T 152..461 CDD:133004 127/322 (39%)
Ricin_B_lectin 474..597 CDD:279046 30/143 (21%)
RICIN 481..599 CDD:238092 30/137 (22%)
GALNT8NP_059113.1 transmembrane domain 7..29
stem region 30..148 14/64 (22%)
SMC_N <48..>161 CDD:330553 19/77 (25%)
GT1 motif 182..298 51/116 (44%)
pp-GalNAc-T 184..485 CDD:133004 127/322 (39%)
Gal/GalNAc transferase motif 358..397 18/39 (46%)
RICIN 498..624 CDD:238092 31/144 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.