DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant1 and GALNT2

DIOPT Version :9

Sequence 1:NP_611043.1 Gene:Pgant1 / 36717 FlyBaseID:FBgn0034025 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_016856452.1 Gene:GALNT2 / 2590 HGNCID:4124 Length:636 Species:Homo sapiens


Alignment Length:496 Identity:199/496 - (40%)
Similarity:265/496 - (53%) Gaps:42/496 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LCF-------ILYSKVQQNGSPEEPPVAPLVRAAALRGHGRERFEAYSDSENEIARPATQSPYEQ 77
            |||       |.|......||          ..|...|.|..|.|.:::.:....:....|..|:
Human     9 LCFAFLWVLGIAYYMYSGGGS----------ALAGGAGGGAGRKEDWNEIDPIKKKDLHHSNGEE 63

  Fly    78 IIQL--DLQKQKVGLGEQGVAVHLSGAAKERGDEIYKKIALNEELSEQLTYNRSVGDHRNPLCAK 140
            ..|.  .|...||...:.....::.|.....|.:.|.:...|:..|::|..:|::.|.|:..|.:
Human    64 KAQSMETLPPGKVRWPDFNQEAYVGGTMVRSGQDPYARNKFNQVESDKLRMDRAIPDTRHDQCQR 128

  Fly   141 QRFDSDSLPTASVVIIFFNEPYSVLLRTVHSTLSTCNEKALKEIILVDDGSDNVELGAKLDYYVR 205
            :::..| ||..||||.|.||..|.|||||.|.|.......:||||||||.|::.|.||.|.    
Human   129 KQWRVD-LPATSVVITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSNDPEDGALLG---- 188

  Fly   206 TRIPSGKVTILRLKNRLGLIRARLAGARIATGDVLIFLDAHCEGNIGWCEPLLQRIKESRTSVLV 270
             :|.  ||.:||...|.||:|:|:.||..|...||.|||:|||.|..|.||||:|:.|.||.|:.
Human   189 -KIE--KVRVLRNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNEHWLEPLLERVAEDRTRVVS 250

  Fly   271 PIIDVIDANDFQYSTNGYKSFQVGGFQWNGHFDWINL-PEREKQRQRRECKQEREICPAYSPTMA 334
            ||||||:.::|||.  |..:...|||.||..|.|..: ||:.:.|      |...:.|..:|.:|
Human   251 PIIDVINMDNFQYV--GASADLKGGFDWNLVFKWDYMTPEQRRSR------QGNPVAPIKTPMIA 307

  Fly   335 GGLFAIDRRYFWEVGSYDEQMDGWGGENLEMSFRIWQCGGTIETIPCSRVGHIFRDFHPYKFPND 399
            ||||.:|:.||.|:|.||..||.|||||||:|||:|||||::|.||||||||:||..|||.||..
Human   308 GGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKQHPYTFPGG 372

  Fly   400 RDT-HGINTARMALVWMDEYINIFFLNRPDLKFHADIGDVTHRVMLRKKLRCKSFEWYLKNIYPE 463
            ..| ...||.|.|.||||||.|.::...|..: :...|::..|:.|||||.||.|:|||:|:|||
Human   373 SGTVFARNTRRAAEVWMDEYKNFYYAAVPSAR-NVPYGNIQSRLELRKKLSCKPFKWYLENVYPE 436

  Fly   464 KFVPTKDVQGWGKVHAVNSNICLDDLLQNNEKPYNAGLYPC 504
            ..||......:|.:.  ....|||.|  .:......|:|.|
Human   437 LRVPDHQDIAFGALQ--QGTNCLDTL--GHFADGVVGVYEC 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant1NP_611043.1 WcaA 147..426 CDD:223539 142/280 (51%)
pp-GalNAc-T 152..461 CDD:133004 155/310 (50%)
Ricin_B_lectin 474..597 CDD:279046 8/31 (26%)
RICIN 481..599 CDD:238092 7/24 (29%)
GALNT2XP_016856452.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.