DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant1 and GALNTL5

DIOPT Version :9

Sequence 1:NP_611043.1 Gene:Pgant1 / 36717 FlyBaseID:FBgn0034025 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_016867282.1 Gene:GALNTL5 / 168391 HGNCID:21725 Length:496 Species:Homo sapiens


Alignment Length:467 Identity:185/467 - (39%)
Similarity:243/467 - (52%) Gaps:52/467 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FYGKLIIFILVALCFILYSKVQQNGSPEEPPVAPLVRAAALRGHGRERFEAYSDSE---NEIARP 69
            |||.|...|..||.||.   :..|            ..::.:...:|...|:|..:   .:|...
Human    63 FYGSLTFGIWTALLFIY---LHHN------------HVSSWQKKSQEPLSAWSPGKKVHQQIIYG 112

  Fly    70 ATQSPYEQII--QLDLQKQKVGLGEQGVAVHLSGAAKERGDEIYK---KIALNEELSEQLTYNRS 129
            :.|.|...:|  :.|..|.|..||..         ......|::|   |...|..:|..|...|.
Human   113 SEQIPKPHVIVKRTDEDKAKSMLGTD---------FNHTNPELHKELLKYGFNVIISRSLGIERE 168

  Fly   130 VGDHRNPLCAKQRFDSDSLPTASVVIIFFNEPYSVLLRTVHSTLSTCNEKALKEIILVDDGSDNV 194
            |.|.|:.:|.::.:.: .|||||:||.|:||..:.|.:|:.|..:......|:|||||||.|...
Human   169 VPDTRSKMCLQKHYPA-RLPTASIVICFYNEECNALFQTMSSVTNLTPHYFLEEIILVDDMSKVD 232

  Fly   195 ELGAKLDYYVRTRIPSGKVTILRLKNRLGLIRARLAGARIATGDVLIFLDAHCEGNIGWCEPLLQ 259
            :|..||||::.|.  .|||.|:|.|.|.|||||||.||..|:||||:|||:|||.|..|.||||.
Human   233 DLKEKLDYHLETF--RGKVKIIRNKKREGLIRARLIGASHASGDVLVFLDSHCEVNRVWLEPLLH 295

  Fly   260 RIKESRTSVLVPIIDVIDANDFQYSTNGYKSFQVGGFQWNGHFDWINLPEREKQRQRRECKQERE 324
            .|.:....|:.|:|||||....:|..:   ....|.|.||..|.|.|:...|........|    
Human   296 AIAKDPKMVVCPLIDVIDDRTLEYKPS---PLVRGTFDWNLQFKWDNVFSYEMDGPEGSTK---- 353

  Fly   325 ICPAYSPTMAGGLFAIDRRYFWEVGSYDEQMDGWGGENLEMSFRIWQCGGTIETIPCSRVGHIFR 389
              |..||.|:||:|||.|.||.|:|.||:.||.||.||||:|.|||.|||.:..|||||||||.:
Human   354 --PIRSPAMSGGIFAIRRHYFNEIGQYDKDMDFWGRENLELSLRIWMCGGQLFIIPCSRVGHISK 416

  Fly   390 DFHPYKFPN---DRDTHGINTARMALVWMDEYINIFFLNRPDLKFHADIGDVTHRVMLRKKLRCK 451
              .....|:   ...||  |..|:..||:|||...|||.:|.||: ...|::..||.|||:|.||
Human   417 --KQTGKPSTIISAMTH--NYLRLVHVWLDEYKEQFFLRKPGLKY-VTYGNIRERVELRKRLGCK 476

  Fly   452 SFEWYLKNIYPE 463
            ||:|||.|::||
Human   477 SFQWYLDNVFPE 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant1NP_611043.1 WcaA 147..426 CDD:223539 132/281 (47%)
pp-GalNAc-T 152..461 CDD:133004 146/311 (47%)
Ricin_B_lectin 474..597 CDD:279046
RICIN 481..599 CDD:238092
GALNTL5XP_016867282.1 GT2 187..437 CDD:224137 123/264 (47%)
pp-GalNAc-T 190..486 CDD:133004 146/311 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.