| Sequence 1: | NP_611043.1 | Gene: | Pgant1 / 36717 | FlyBaseID: | FBgn0034025 | Length: | 601 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_061512656.1 | Gene: | LOC1280687 / 1280687 | VectorBaseID: | AGAMI1_007732 | Length: | 616 | Species: | Anopheles gambiae |
| Alignment Length: | 49 | Identity: | 12/49 - (24%) |
|---|---|---|---|
| Similarity: | 23/49 - (46%) | Gaps: | 2/49 - (4%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 108 NFFK--GRVFGEMESHVNAHIDDGVMTASVVLPDETYHIEPSWRHLPHL 154 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Pgant1 | NP_611043.1 | pp-GalNAc-T | 152..461 | CDD:133004 | 1/3 (33%) |
| beta-trefoil_Ricin_Pgant1-like | 468..601 | CDD:467337 | |||
| LOC1280687 | XP_061512656.1 | None | |||
| Blue background indicates that the domain is not in the aligned region. | |||||