DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant1 and GALNT6

DIOPT Version :9

Sequence 1:NP_611043.1 Gene:Pgant1 / 36717 FlyBaseID:FBgn0034025 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_009141.2 Gene:GALNT6 / 11226 HGNCID:4128 Length:622 Species:Homo sapiens


Alignment Length:523 Identity:210/523 - (40%)
Similarity:276/523 - (52%) Gaps:65/523 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 KERGDEIYKKIALNEELSEQLTYNRSVG-DHRNPLCAKQRF-DSDSLPTASVVIIFFNEPYSVLL 166
            ||.|   |||...|...|::::..||:| |.|.|.|..|:| ....|.|.||:|:|.||.:|.||
Human   133 KEEG---YKKHCFNAFASDRISLQRSLGPDTRPPECVDQKFRRCPPLATTSVIIVFHNEAWSTLL 194

  Fly   167 RTVHSTLSTCNEKALKEIILVDDGSDNVELGAKLDYYVRTRIPSGKVTILRLKNRLGLIRARLAG 231
            |||:|.|.|.....|||||||||.|....|..||:.||:   ....|.::|.:.|.|||.|||.|
Human   195 RTVYSVLHTTPAILLKEIILVDDASTEEHLKEKLEQYVK---QLQVVRVVRQEERKGLITARLLG 256

  Fly   232 ARIATGDVLIFLDAHCEGNIGWCEPLLQRIKESRTSVLVPIIDVIDANDFQYSTNGYKSFQ---- 292
            |.:|..:||.|||||||...||.||||.||.|.:|.|:.|.|..||.|.|:::    |..|    
Human   257 ASVAQAEVLTFLDAHCECFHGWLEPLLARIAEDKTVVVSPDIVTIDLNTFEFA----KPVQRGRV 317

  Fly   293 --VGGFQWNGHFDWINLPEREKQRQRRECKQEREICPAYSPTMAGGLFAIDRRYFWEVGSYDEQM 355
              .|.|.|:..|.|..||..||||::      .|..|..|||.|||||:|.:.||..:|:||.||
Human   318 HSRGNFDWSLTFGWETLPPHEKQRRK------DETYPIKSPTFAGGLFSISKSYFEHIGTYDNQM 376

  Fly   356 DGWGGENLEMSFRIWQCGGTIETIPCSRVGHIFRDFHPYKFPNDRDTHGINTARMALVWMDEYIN 420
            :.|||||:|||||:|||||.:|.||||.|||:||...|:.||........|..|:|.||||.|..
Human   377 EIWGGENVEMSFRVWQCGGQLEIIPCSVVGHVFRTKSPHTFPKGTSVIARNQVRLAEVWMDSYKK 441

  Fly   421 IFF---LNRPDLKFHADIGDVTHRVMLRKKLRCKSFEWYLKNIYPEKFVPTKDVQGWGKVHAVNS 482
            ||:   |....:......||::.|:.||::|.|.:|.|||.|:|||.|||......:|.:..:.:
Human   442 IFYRRNLQAAKMAQEKSFGDISERLQLREQLHCHNFSWYLHNVYPEMFVPDLTPTFYGAIKNLGT 506

  Fly   483 NICLDDLLQNNEKPYNAGLYPCGKVLQKSQLFSFTNTNVLRNEL----------------SC-AT 530
            |.|| |:.:||.......:|.| ..|..:|.|.:|....||:.:                || .|
Human   507 NQCL-DVGENNRGGKPLIMYSC-HGLGGNQYFEYTTQRDLRHNIAKQLCLHVSKGALGLGSCHFT 569

  Fly   531 VQHSESPPYRVVMVPCMENDEFNEQWRYEHQHII-HSNTGMCLDHQGLKSLDDAQVAPCDPHSES 594
            .::|:.|.              :|:|......:| :|.:|.||..|..|    ..:|||:|....
Human   570 GKNSQVPK--------------DEEWELAQDQLIRNSGSGTCLTSQDKK----PAMAPCNPSDPH 616

  Fly   595 QRW 597
            |.|
Human   617 QLW 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant1NP_611043.1 WcaA 147..426 CDD:223539 140/287 (49%)
pp-GalNAc-T 152..461 CDD:133004 150/317 (47%)
Ricin_B_lectin 474..597 CDD:279046 34/140 (24%)
RICIN 481..599 CDD:238092 34/135 (25%)
GALNT6NP_009141.2 Catalytic subdomain A 176..285 59/111 (53%)
pp-GalNAc-T 180..485 CDD:133004 150/317 (47%)
Catalytic subdomain B 348..410 40/61 (66%)
Ricin_B_lectin 497..619 CDD:306998 34/141 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D261568at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11675
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.