DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir52d and Ir7f

DIOPT Version :9

Sequence 1:NP_611042.2 Gene:Ir52d / 36716 FlyBaseID:FBgn0050464 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_001138177.1 Gene:Ir7f / 7354418 FlyBaseID:FBgn0259188 Length:621 Species:Drosophila melanogaster


Alignment Length:102 Identity:21/102 - (20%)
Similarity:47/102 - (46%) Gaps:11/102 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 EGNPIYVDQFRNMQGALLKSITFNLIPGSMAYRDPKTGQEKHIGYVANLLNNFVEKVNATLDMQV 233
            :.:.::.|:...|.|..|..:|::..|......|||..:.:..|:...|:.:...::|.:|::  
  Fly   212 KASQMFPDKLSQMHGCPLTVLTWHQPPFVELVWDPKHNRSRGSGFEIQLVEHLARRMNFSLEL-- 274

  Fly   234 KLHKAGKKTSFYNITKWASED--------LVDIGMSY 262
             ::.|..:.:.|.:.:.:||.        .|:|.|.|
  Fly   275 -VNIALLRPNAYRLAEGSSEGPIEKLLQRNVNISMGY 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir52dNP_611042.2 None
Ir7fNP_001138177.1 Periplasmic_Binding_Protein_Type_2 231..>358 CDD:304360 17/83 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.