DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir52d and Ir92a

DIOPT Version :9

Sequence 1:NP_611042.2 Gene:Ir52d / 36716 FlyBaseID:FBgn0050464 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_001097845.2 Gene:Ir92a / 42415 FlyBaseID:FBgn0038789 Length:678 Species:Drosophila melanogaster


Alignment Length:481 Identity:98/481 - (20%)
Similarity:170/481 - (35%) Gaps:122/481 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 IYVDQFRNMQ--GALLKSITF------NLIPGSMAYRDPKTGQEKH-----IGYVANLLNNFVEK 224
            :|.::..|:|  ..|:.|||:      |.:|......||...|..:     .|..||::..|.: 
  Fly   234 LYPNKLLNLQRRSLLVGSITYVPYTITNYVPAGQGDVDPIHPQWPNRSLTFDGAEANVMKTFCQ- 297

  Fly   225 VNATLDMQVKLHKAGKKTSFYNITKWAS---------------EDLVD--IGMSYAAYFEMTNFD 272
                      :|....:...|....|..               |..|:  ||..|..|..:|.  
  Fly   298 ----------VHNCHLRVEAYGADNWGGIYDNESSDGMLGDIYEQRVEMAIGCIYNWYDGITE-- 350

  Fly   273 TISYPYLMTSTCFMVPLPDMMPNSEIYMGIVDPPVLVVLIAIFCIFSVMLNYIKQRSWR------ 331
             .|:....:|...:.|.|..:|:....:...:....:|||:...|....|.::|..|:|      
  Fly   351 -TSHTIARSSVTILGPAPAPLPSWRTNIMPFNNRAWLVLISTLVICGTFLYFMKYVSYRLRYSGT 414

  Fly   332 ------SLSLVNVLLNDICLRGFLAQ---PFPFPRQSNRKLKLISMLVCFFSVITTTMYTSYLQS 387
                  |..|...:|:...|  |:.|   |..|.|.:.|  ..::.::| .::....:|:..|:|
  Fly   415 QVKFHHSRKLEKSMLDIFAL--FIQQPSAPLSFDRFAPR--FFLATILC-ATITLENIYSGQLKS 474

  Fly   388 FMWGP----PIDPKMCSFADLENSRYKLA---------IRRYDIE----MLRPFNVSMDHVVVFD 435
            .:..|    |:|    :......|.:|.:         ::..|:|    :.|.|.|         
  Fly   475 MLTFPFYSAPVD----TIEKWAQSGWKWSAPSIIWVHTVQSSDLETEQILARNFEV--------- 526

  Fly   436 ESSQLEYLRD-SFDDNYMYPMSALSWSAFKEQQKLFAFPLFYYSEKLCLKPISFFSF----PIRR 495
              ....||.: ||..||.:.:..||..:......:....|   ..::.|....:|.:    .||.
  Fly   527 --HDYSYLSNVSFMPNYGFGIERLSSGSLSVGDYVSTEAL---ENRIVLHDDLYFDYTRAVSIRG 586

  Fly   496 HLPYRDLFEEHMLQQNEFGLSTYWIDRSFSD--MVRLKLATMNDFS-------PPRLEDYIEVSD 551
            .:...:| .:|:....|.||..:| :..|.|  |.:.|...:.|.:       .|:..|...::.
  Fly   587 WILMPEL-NKHIRTCQETGLYFHW-ELEFIDKYMDKKKQEVLMDLANGHKVKGAPQALDVRNIAG 649

  Fly   552 LSWV--FGMYFTGLGISCCCFGLELL 575
            ..:|  ||:.|.|     |....|||
  Fly   650 ALFVLAFGVAFAG-----CALVAELL 670



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.