DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir52d and Ir40a

DIOPT Version :10

Sequence 1:NP_611042.2 Gene:Ir52d / 36716 FlyBaseID:FBgn0050464 Length:594 Species:Drosophila melanogaster
Sequence 2:NP_610140.4 Gene:Ir40a / 35449 FlyBaseID:FBgn0259683 Length:732 Species:Drosophila melanogaster


Alignment Length:171 Identity:32/171 - (18%)
Similarity:62/171 - (36%) Gaps:70/171 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 LTCEF-KAEREENYQTLKKLQMNRRLILLNGNIKPDSVCDFYSKKDQYNIAMVNNNFHQVGIIYA 153
            ||.:| :..||....||::||                            .||:::.:        
  Fly   487 LTSQFARPAREPPINTLQRLQ----------------------------AAMIHDGY-------- 515

  Fly   154 CRLFQERNYEKVYLSEGNPIYVDQFRNMQGALLKSITFNLIPGSMAYRDPKTGQEKHIGYVANLL 218
             ||:.|:....:.:.|..   .:.||.:. ||::....|         ||:       |:     
  Fly   516 -RLYVEKESSSLEMLENG---TELFRQLY-ALMRQQVIN---------DPQ-------GF----- 554

  Fly   219 NNFVEKVNATLDM-----QVKLHKAGKKTSFYNITKWASED 254
              |::.|.|.:.:     :.|....|::|.|:|:.::.|.:
  Fly   555 --FIDSVEAGIKLIAEGGEDKAVLGGRETLFFNVQQYGSNN 593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir52dNP_611042.2 None
Ir40aNP_610140.4 Lig_chan-Glu_bd <265..336 CDD:463166
Periplasmic_Binding_Protein_Type_2 297..>391 CDD:473866
Periplasmic_Binding_Protein_Type_2 <496..637 CDD:473866 29/162 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.