DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ISLR and CG7896

DIOPT Version :9

Sequence 1:NP_005536.1 Gene:ISLR / 3671 HGNCID:6133 Length:428 Species:Homo sapiens
Sequence 2:NP_651754.1 Gene:CG7896 / 43552 FlyBaseID:FBgn0039728 Length:1392 Species:Drosophila melanogaster


Alignment Length:474 Identity:112/474 - (23%)
Similarity:167/474 - (35%) Gaps:144/474 - (30%)


- Green bases have known domain annotations that are detailed below.


Human     3 ELHLLWWALLL------------GLAQACPEPCDCGEKYGFQIADCAYRDLESVPPGF---PANV 52
            |||:|....||            ||.:.|   .|..|.|      .....|.|||...   |:.:
  Fly   155 ELHVLKNLRLLDLSGNKIKLIEEGLLKGC---MDLKEFY------IDRNSLTSVPTNSLNGPSAL 210

Human    53 TTLSLSANRLPGLPEGAFREVPLLQSLWLAHNEIRTVAAGALASL-------------SHLKS-- 102
            ..|||..|::..|...:|.....|:.:.|.||.||::.:.|...|             |||.|  
  Fly   211 RHLSLRQNQIGSLLADSFNAQRQLEIIDLRHNVIRSIDSLAFKGLQKIREIKLAGNRISHLNSDV 275

Human   103 ---------LDLSHNLISDFAWSDLHNLSALQLLKMDSNELTFIPRDAFRSLRALRSLQLNHNRL 158
                     ||||.|....|....|..:..|:.|.:.||.|..:.....:.:|:|.||.::.|.:
  Fly   276 FEKLQSLQKLDLSENFFGQFPTVALAAVPGLKHLNLSSNMLQQLDYTHMQVVRSLESLDISRNTI 340

Human   159 HTLAEGTFTPLTALSHLQINENPF-----DCTCGIVWLKTWALTTAVSIPEQDNIACTSPHVLKG 218
            .|:..|||..:.||.:|.::.|..     |...|:..|:|       .|.:.:||.     ::.|
  Fly   341 TTITPGTFREMGALKYLDLSLNSLRTIEDDALEGLDSLQT-------LIIKDNNIL-----LVPG 393

Human   219 TPLSRLPPLPCSAPSVQLSYQPSQDGAELRPGFVLALHCDVDGQ------PAPQLHWHI--QIPS 275
            :.|.|||.|    .|:||.|..           |.||..::.|.      ....|..::  ::|.
  Fly   394 SALGRLPQL----TSLQLDYNR-----------VAALSAEILGSLQAGDITTLSLSRNVIRELPP 443

Human   276 GIVEITSPNVGTDGRALPGTPVA------------------SSQPRFQAFANGSLLIPDFGKLEE 322
            |..::.|.....|   |.|..:|                  .||.|.........::|:...|: 
  Fly   444 GSFQMFSSLHTLD---LSGNSLAVINADTFAGLESTLMALKLSQNRLTGLGGAPWVLPELRSLD- 504

Human   323 GTYSCLATNELGSAESSVDVAL------------ATPGEGG----------EDTLG---RRFHGK 362
                 |:.|.|....|::...|            .||..|.          .|..|   |:..|.
  Fly   505 -----LSGNTLTELPSTIFEELENVQSLNLSGNHLTPLTGALFKPLDRLQVIDLSGCNIRQISGD 564

Human   363 AVEG----KGCYTVDNEVQ 377
            .:.|    |..|..||::|
  Fly   565 LLAGLQDLKHIYLNDNQLQ 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ISLRNP_005536.1 leucine-rich repeat 32..51 CDD:275380 5/21 (24%)
LRR_8 51..110 CDD:316378 23/82 (28%)
LRR 1 51..72 6/20 (30%)
leucine-rich repeat 52..75 CDD:275380 6/22 (27%)
LRR 2 75..96 7/20 (35%)
leucine-rich repeat 76..99 CDD:275380 8/35 (23%)
LRR_8 98..158 CDD:316378 21/70 (30%)
LRR 3 99..122 10/33 (30%)
leucine-rich repeat 100..123 CDD:275380 9/33 (27%)
LRR 4 123..144 5/20 (25%)
leucine-rich repeat 124..147 CDD:275380 5/22 (23%)
LRR 5 147..168 8/20 (40%)
leucine-rich repeat 148..171 CDD:275380 8/22 (36%)
PCC 153..>227 CDD:188093 21/78 (27%)
I-set 239..340 CDD:333254 21/126 (17%)
CG7896NP_651754.1 LRR_8 109..172 CDD:290566 6/16 (38%)
leucine-rich repeat 109..132 CDD:275380
LRR_RI <132..338 CDD:238064 51/191 (27%)
leucine-rich repeat 133..161 CDD:275380 4/5 (80%)
LRR_8 160..220 CDD:290566 17/68 (25%)
leucine-rich repeat 162..185 CDD:275380 5/25 (20%)
leucine-rich repeat 186..209 CDD:275380 7/28 (25%)
leucine-rich repeat 210..233 CDD:275380 6/22 (27%)
LRR_8 232..290 CDD:290566 16/57 (28%)
leucine-rich repeat 234..257 CDD:275380 8/22 (36%)
leucine-rich repeat 258..281 CDD:275380 4/22 (18%)
LRR_RI 273..535 CDD:238064 65/297 (22%)
LRR_8 281..338 CDD:290566 16/56 (29%)
leucine-rich repeat 282..329 CDD:275380 12/46 (26%)
LRR_8 328..388 CDD:290566 18/66 (27%)
leucine-rich repeat 330..353 CDD:275380 8/22 (36%)
leucine-rich repeat 354..377 CDD:275380 5/22 (23%)
leucine-rich repeat 378..401 CDD:275380 9/34 (26%)
leucine-rich repeat 402..425 CDD:275380 9/37 (24%)
leucine-rich repeat 428..451 CDD:275380 3/22 (14%)
LRR_8 429..487 CDD:290566 10/60 (17%)
leucine-rich repeat 452..473 CDD:275380 4/23 (17%)
leucine-rich repeat 477..497 CDD:275378 3/19 (16%)
LRR_8 498..558 CDD:290566 12/65 (18%)
leucine-rich repeat 500..523 CDD:275380 6/28 (21%)
LRR_RI 502..769 CDD:238064 19/88 (22%)
leucine-rich repeat 524..547 CDD:275380 3/22 (14%)
leucine-rich repeat 548..571 CDD:275380 5/22 (23%)
LRR_8 572..630 CDD:290566 5/12 (42%)
leucine-rich repeat 572..595 CDD:275380 5/12 (42%)
leucine-rich repeat 596..619 CDD:275380
LRR_8 619..678 CDD:290566
leucine-rich repeat 620..643 CDD:275380
leucine-rich repeat 644..667 CDD:275380
LRR_8 666..726 CDD:290566
leucine-rich repeat 668..691 CDD:275380
leucine-rich repeat 692..715 CDD:275380
LRR_8 714..774 CDD:290566
leucine-rich repeat 716..739 CDD:275380
leucine-rich repeat 740..761 CDD:275380
leucine-rich repeat 764..789 CDD:275380
leucine-rich repeat 790..810 CDD:275380
leucine-rich repeat 818..850 CDD:275380
leucine-rich repeat 863..883 CDD:275378
LRR_RI <878..1070 CDD:238064
LRR_8 884..944 CDD:290566
LRR_4 884..925 CDD:289563
leucine-rich repeat 884..907 CDD:275380
leucine-rich repeat 908..933 CDD:275380
leucine-rich repeat 934..955 CDD:275380
leucine-rich repeat 958..982 CDD:275380
leucine-rich repeat 983..1055 CDD:275380
leucine-rich repeat 1009..1033 CDD:275380
leucine-rich repeat 1058..1085 CDD:275380
TPKR_C2 1121..1168 CDD:301599
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24366
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.