DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ISLR and kek1

DIOPT Version :9

Sequence 1:NP_005536.1 Gene:ISLR / 3671 HGNCID:6133 Length:428 Species:Homo sapiens
Sequence 2:NP_001303320.1 Gene:kek1 / 34688 FlyBaseID:FBgn0015399 Length:880 Species:Drosophila melanogaster


Alignment Length:382 Identity:85/382 - (22%)
Similarity:142/382 - (37%) Gaps:79/382 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    19 CPEPCDCGEKYGFQIADCAYRDLESVPPGFPANVTTLSLSANRLPGLPEGAFREVPL--LQSLWL 81
            |...|.|..|.|.|..:|..|.|..:|.....|...|.:|.|:|..|....|....|  ||.|:|
  Fly    90 CQTVCACKWKGGKQTVECIDRHLIQIPEHIDPNTQVLDMSGNKLQTLSNEQFIRANLLNLQKLYL 154

Human    82 AHNEIRTVAAGALASLSHLKSLDLSHNLISDFAWSDLHNLSALQLLKMDSN-------------- 132
            .:.:|..:.......|::|..|||||||:.......|.::.:|:.|.:.||              
  Fly   155 RNCKIGEIERETFKGLTNLVELDLSHNLLVTVPSLALGHIPSLRELTLASNHIHKIESQAFGNTP 219

Human   133 ----------ELTFIPRDAFRSLRALRSLQLNHNRLHTLAEGTFTPLTALSHLQINENPFDCTCG 187
                      ::..|...||..|:.|..|:||.|:|..|...|...|:.|..:::::||:.|.|.
  Fly   220 SLHKLDLSHCDIQTISAQAFGGLQGLTLLRLNGNKLSELLPKTIETLSRLHGIELHDNPWLCDCR 284

Human   188 IVWLKTWALTTAVSIPEQDNIACTSPHVLKGTP---LSR------LPPLPCSAPSVQLSYQPSQD 243
            :...|.|.:...:..|       .:| |..|.|   :.|      :....|....:.:|:.    
  Fly   285 LRDTKLWLMKRNIPYP-------VAP-VCSGGPERIIDRSFADLHVDEFACRPEMLPISHY---- 337

Human   244 GAELRPGFVLALHCDVDGQPAPQLHWHIQIPSGIVEITSPNVGTDGRALPGTPVASSQPRFQAF- 307
             .|...|...::.|.....||..::|:                .:||.|......::..|.... 
  Fly   338 -VEAAMGENASITCRARAVPAANINWY----------------WNGRLLANNSAFTAYQRIHMLE 385

Human   308 -------ANGSLLIPDFGKLEEGTYSCLATNELGSAESSVDV-------ALATPGEG 350
                   ....|::.:..:.:...:.|:|.|..|.||::..:       .:|:.|.|
  Fly   386 QVEGGFEKRSKLVLTNAQETDSSEFYCVAENRAGMAEANFTLHVSMRAAGMASLGSG 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ISLRNP_005536.1 leucine-rich repeat 32..51 CDD:275380 5/18 (28%)
LRR_8 51..110 CDD:316378 21/60 (35%)
LRR 1 51..72 7/20 (35%)
leucine-rich repeat 52..75 CDD:275380 6/22 (27%)
LRR 2 75..96 6/22 (27%)
leucine-rich repeat 76..99 CDD:275380 6/22 (27%)
LRR_8 98..158 CDD:316378 22/83 (27%)
LRR 3 99..122 9/22 (41%)
leucine-rich repeat 100..123 CDD:275380 9/22 (41%)
LRR 4 123..144 7/44 (16%)
leucine-rich repeat 124..147 CDD:275380 8/46 (17%)
LRR 5 147..168 8/20 (40%)
leucine-rich repeat 148..171 CDD:275380 9/22 (41%)
PCC 153..>227 CDD:188093 20/82 (24%)
I-set 239..340 CDD:333254 17/108 (16%)
kek1NP_001303320.1 leucine-rich repeat 103..122 CDD:275380 5/18 (28%)
LRR_RI <119..277 CDD:238064 41/157 (26%)
leucine-rich repeat 123..148 CDD:275380 7/24 (29%)
LRR_8 148..207 CDD:290566 19/58 (33%)
leucine-rich repeat 149..172 CDD:275380 6/22 (27%)
leucine-rich repeat 173..196 CDD:275380 9/22 (41%)
LRR_8 195..255 CDD:290566 13/59 (22%)
leucine-rich repeat 197..220 CDD:275380 4/22 (18%)
leucine-rich repeat 221..244 CDD:275380 4/22 (18%)
leucine-rich repeat 245..268 CDD:275380 9/22 (41%)
LRRCT 277..327 CDD:214507 12/57 (21%)
IG_like 338..429 CDD:214653 17/106 (16%)
Ig 346..426 CDD:143165 15/95 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.