DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SRPK and p38a

DIOPT Version :9

Sequence 1:NP_001369087.1 Gene:SRPK / 36706 FlyBaseID:FBgn0286813 Length:1009 Species:Drosophila melanogaster
Sequence 2:NP_001163711.1 Gene:p38a / 42866 FlyBaseID:FBgn0015765 Length:366 Species:Drosophila melanogaster


Alignment Length:173 Identity:52/173 - (30%)
Similarity:81/173 - (46%) Gaps:30/173 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   597 DECNVHVKIADLGNACWVDRHFTEDIQTRQYRSLEVIIG-AGYNTSADIWSTACMVFELATGDYL 660
            ::|  .::|.|.|.|...:...|..:.||.||:.|:::. ..|:.:.||||..|::.||.|...|
  Fly   164 EDC--ELRILDFGLARPTENEMTGYVATRWYRAPEIMLNWMHYDQTVDIWSVGCIMAELITRRTL 226

  Fly   661 FEPHSGESYTRDEDHLAH---IIELLGPIPREILLN-GTYAAKSFTRSCELRNISGLKPWGLMDV 721
            |.         ..||:..   |:|:||..|.|.|.. .:.:|:|:     ::::..:|.....:|
  Fly   227 FP---------GTDHIHQLNLIMEMLGTPPAEFLKKISSESARSY-----IQSLPPMKGRSFKNV 277

  Fly   722 LLEKYEWSQKDAASFA-SFLTPMLEFDPNKRATAAECLQHPWL 763
            .        |:|...| ..|..|||.|..||.||.|.|.||:|
  Fly   278 F--------KNANPLAIDLLEKMLELDAEKRITAEEALSHPYL 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SRPKNP_001369087.1 PKc_like 159..>318 CDD:419665
PKc_like <600..763 CDD:419665 50/168 (30%)
p38aNP_001163711.1 STKc_p38 9..354 CDD:143356 52/173 (30%)
S_TKc 25..312 CDD:214567 51/171 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24055
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.