DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SRPK and rl

DIOPT Version :9

Sequence 1:NP_001369087.1 Gene:SRPK / 36706 FlyBaseID:FBgn0286813 Length:1009 Species:Drosophila melanogaster
Sequence 2:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster


Alignment Length:172 Identity:54/172 - (31%)
Similarity:82/172 - (47%) Gaps:32/172 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   603 VKIADLGNACWVD-RH-----FTEDIQTRQYRSLEVIIGA-GYNTSADIWSTACMVFELATGDYL 660
            :||.|.|.|...| .|     .||.:.||.||:.|:::.: ||..|.||||..|::.|:.:...:
  Fly   176 LKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPI 240

  Fly   661 FEPHSGESYTRDEDHLAHIIELLGPIPR---EILLNGTYAAKSFTRSCELR-NISGLKPWGLMDV 721
            |   .|:.|.   |.|.||:.:||...|   |.::|  ..|:::..|...: |:    ||..:  
  Fly   241 F---PGKHYL---DQLNHILGVLGSPSRDDLECIIN--EKARNYLESLPFKPNV----PWAKL-- 291

  Fly   722 LLEKYEWSQKDAASFASFLTPMLEFDPNKRATAAECLQHPWL 763
                  :...||.:. ..|..||.|:|:||....|.|.||:|
  Fly   292 ------FPNADALAL-DLLGKMLTFNPHKRIPVEEALAHPYL 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SRPKNP_001369087.1 PKc_like 159..>318 CDD:419665
PKc_like <600..763 CDD:419665 53/170 (31%)
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 54/172 (31%)
S_TKc 38..326 CDD:214567 53/170 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24055
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.