DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr51 and nhr-81

DIOPT Version :9

Sequence 1:NP_611032.2 Gene:Hr51 / 36702 FlyBaseID:FBgn0034012 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_493118.2 Gene:nhr-81 / 191728 WormBaseID:WBGene00003671 Length:347 Species:Caenorhabditis elegans


Alignment Length:96 Identity:32/96 - (33%)
Similarity:53/96 - (55%) Gaps:13/96 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 LGLI------CVVCGDT-SSGKHYGILACNGCSGFFKRSVRRKLIYRCQAGTGRCVVDKAHRNQC 164
            :|||      |.||.:| ::.:|:||::|..|:.||:||:..:  |.|.| ..||.:....:..|
 Worm     1 MGLISKNRGPCQVCHNTETTRRHFGIISCTACAAFFRRSIGMQ--YLCTA-ENRCTISFDRKFFC 62

  Fly   165 QACRLKKCLQMGMNKDAVQNERQPRNTATIR 195
            :|||...||:.||..:.:   |:.:|...:|
 Worm    63 RACRYASCLKAGMKLELI---RKQKNNIYLR 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr51NP_611032.2 NR_DBD_PNR 103..194 CDD:143528 31/93 (33%)
NR_LBD_Tlx_PNR_like 354..569 CDD:132748
nhr-81NP_493118.2 ZnF_C4 10..78 CDD:197701 26/70 (37%)
HOLI 184..332 CDD:214658
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.