powered by:
Protein Alignment Hr51 and nhr-244
DIOPT Version :9
Sequence 1: | NP_611032.2 |
Gene: | Hr51 / 36702 |
FlyBaseID: | FBgn0034012 |
Length: | 582 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_492926.1 |
Gene: | nhr-244 / 191495 |
WormBaseID: | WBGene00014186 |
Length: | 173 |
Species: | Caenorhabditis elegans |
Alignment Length: | 61 |
Identity: | 15/61 - (24%) |
Similarity: | 23/61 - (37%) |
Gaps: | 23/61 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 85 ANSMNHSSAAEGSSMTRIKGQNLGLICVVCGDTSSGKHYGILACNGCSGFFKRSVRRKLIY 145
|..:|||.:..|.|::.: ||.:| .|.: ||.....||:|
Worm 67 AKFINHSKSTLGFSLSHL---NLNII-----------EYSV---------FKSFCIWKLVY 104
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.