DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hr51 and nhr-164

DIOPT Version :9

Sequence 1:NP_611032.2 Gene:Hr51 / 36702 FlyBaseID:FBgn0034012 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001309454.1 Gene:nhr-164 / 183381 WormBaseID:WBGene00008056 Length:373 Species:Caenorhabditis elegans


Alignment Length:132 Identity:36/132 - (27%)
Similarity:58/132 - (43%) Gaps:20/132 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 ICVVCGDTSSGK-HYGILACNGCSGFFKRSVRRKLIYRCQAGTGRCVVDKAHRNQCQACRLKKCL 173
            :|.|||.:...: |:|.:.|..||.||:|:|...:.|.|. |..:|   |:...:|:|||.:.|:
 Worm    41 VCAVCGFSCQVQYHFGGVVCGACSAFFRRTVSLNIRYLCD-GDNQC---KSMLKKCRACRFESCV 101

  Fly   174 Q-MGMNKDAVQNER----------QPRNTATIRPETLR----EMEHGRALREAAVAVGVFGPPVL 223
            : .||.:..|:.::          :.|.|.....:.||    ...|.....|.....|.|...:.
 Worm   102 KTAGMKRSLVRRKKPTIKTTPLYIKNRETHVRNEDVLRAFIPSYTHPSPANETVEDKGKFSEKLK 166

  Fly   224 LS 225
            ||
 Worm   167 LS 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hr51NP_611032.2 NR_DBD_PNR 103..194 CDD:143528 28/95 (29%)
NR_LBD_Tlx_PNR_like 354..569 CDD:132748
nhr-164NP_001309454.1 ZnF_C4 42..109 CDD:197701 25/70 (36%)
HOLI 212..358 CDD:214658
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.