DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf51F and ARF3

DIOPT Version :9

Sequence 1:NP_523751.2 Gene:Arf51F / 36699 FlyBaseID:FBgn0013750 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_014737.1 Gene:ARF3 / 854261 SGDID:S000005620 Length:183 Species:Saccharomyces cerevisiae


Alignment Length:173 Identity:103/173 - (59%)
Similarity:138/173 - (79%) Gaps:1/173 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKLLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVG 65
            :.|:|.|:||:|||:|||||||.||||||||||||.:..|:.||||||||||||||||||:||||
Yeast     5 ISKVLGKLFGSKEMKILMLGLDKAGKTTILYKLKLNKIKTSTPTVGFNVETVTYKNVKFNMWDVG 69

  Fly    66 GQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARTELHRIINDREMRDAIILIFANKQDLPDAM 130
            ||.::|||||||:..|..||||:|.:.|:|::||:.||:.||.::||.:.::|::||||||.|||
Yeast    70 GQQRLRPLWRHYFPATTALIFVIDSSARNRMEEAKEELYSIIGEKEMENVVLLVWANKQDLKDAM 134

  Fly   131 KPHEIQEKLGLTR-IRDRNWYVQPSCATSGDGLSEGLIWLTSN 172
            ||.|:.:.|.|.: ::::.|.|..|.|.||.||.|||.|:::|
Yeast   135 KPQEVSDFLELEKNLKNQPWCVIGSNALSGQGLVEGLSWISNN 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf51FNP_523751.2 P-loop_NTPase 1..174 CDD:422963 103/173 (60%)
ARF3NP_014737.1 Arf6 9..177 CDD:206716 101/167 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0071
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1256
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoFinder 1 1.000 - - FOG0000118
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103717
Panther 1 1.100 - - LDO PTHR11711
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.780

Return to query results.
Submit another query.