DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf51F and ARL1

DIOPT Version :9

Sequence 1:NP_523751.2 Gene:Arf51F / 36699 FlyBaseID:FBgn0013750 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_009723.3 Gene:ARL1 / 852462 SGDID:S000000368 Length:183 Species:Saccharomyces cerevisiae


Alignment Length:174 Identity:93/174 - (53%)
Similarity:127/174 - (72%) Gaps:5/174 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKLLSKIF-----GNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFN 60
            ||.:.|.:|     .|||:|||:||||.||||||||:|::|:.|||.||:||||||::|||:|.|
Yeast     1 MGNIFSSMFDKLWGSNKELRILILGLDGAGKTTILYRLQIGEVVTTKPTIGFNVETLSYKNLKLN 65

  Fly    61 VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARTELHRIINDREMRDAIILIFANKQD 125
            |||:|||..|||.||.||..|..:|||||..|:||:..|..|||.::.:.|::||.:|:||||||
Yeast    66 VWDLGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTASKELHLMLQEEELQDAALLVFANKQD 130

  Fly   126 LPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLSEGLIWL 169
            .|.|:...|:.::|.|..::||:|.:..|.|..|:|::|||.||
Yeast   131 QPGALSASEVSKELNLVELKDRSWSIVASSAIKGEGITEGLDWL 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf51FNP_523751.2 P-loop_NTPase 1..174 CDD:422963 93/174 (53%)
ARL1NP_009723.3 Arl1 20..177 CDD:206718 86/155 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.