DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf51F and ARF2

DIOPT Version :9

Sequence 1:NP_523751.2 Gene:Arf51F / 36699 FlyBaseID:FBgn0013750 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_010144.1 Gene:ARF2 / 851418 SGDID:S000002296 Length:181 Species:Saccharomyces cerevisiae


Alignment Length:172 Identity:115/172 - (66%)
Similarity:142/172 - (82%) Gaps:0/172 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQ 67
            ||.|.:||||||||||:|||.|||||:|||||||:.:|||||:|||||||.|||:.|.|||||||
Yeast     7 KLFSNLFGNKEMRILMVGLDGAGKTTVLYKLKLGEVITTIPTIGFNVETVQYKNISFTVWDVGGQ 71

  Fly    68 DKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARTELHRIINDREMRDAIILIFANKQDLPDAMKP 132
            |:||.||||||..|:|:|||:|..||.||.|||..:.|::|:.|:|:|:.|:||||||||:||..
Yeast    72 DRIRSLWRHYYRNTEGVIFVIDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFANKQDLPEAMSA 136

  Fly   133 HEIQEKLGLTRIRDRNWYVQPSCATSGDGLSEGLIWLTSNHK 174
            .||.|||||..||:|.|::|.:|||||:||.|||.||::|.|
Yeast   137 AEITEKLGLHSIRNRPWFIQSTCATSGEGLYEGLEWLSNNLK 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf51FNP_523751.2 P-loop_NTPase 1..174 CDD:422963 114/170 (67%)
ARF2NP_010144.1 ARF 5..179 CDD:128474 115/172 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoFinder 1 1.000 - - FOG0000118
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.