DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf51F and ARFA1F

DIOPT Version :9

Sequence 1:NP_523751.2 Gene:Arf51F / 36699 FlyBaseID:FBgn0013750 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001321560.1 Gene:ARFA1F / 837606 AraportID:AT1G10630 Length:181 Species:Arabidopsis thaliana


Alignment Length:170 Identity:122/170 - (71%)
Similarity:146/170 - (85%) Gaps:0/170 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQ 67
            ||.|::|..|||||||:|||||||||||||||||:.||||||:|||||||.|||:.|.|||||||
plant     7 KLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQ 71

  Fly    68 DKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARTELHRIINDREMRDAIILIFANKQDLPDAMKP 132
            ||||||||||:..|||||||||..||||:.|||.||||::|:.|:|||::|:||||||||:||..
plant    72 DKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNA 136

  Fly   133 HEIQEKLGLTRIRDRNWYVQPSCATSGDGLSEGLIWLTSN 172
            .||.:||||..:|.|:||:|.:|||||:||.|||.||::|
plant   137 AEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNN 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf51FNP_523751.2 P-loop_NTPase 1..174 CDD:422963 122/170 (72%)
ARFA1FNP_001321560.1 PLN00223 1..181 CDD:165788 122/170 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 1 1.010 - - D1362554at2759
OrthoFinder 1 1.000 - - FOG0000118
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.