DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf51F and ARFB1A

DIOPT Version :9

Sequence 1:NP_523751.2 Gene:Arf51F / 36699 FlyBaseID:FBgn0013750 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_179133.1 Gene:ARFB1A / 816020 AraportID:AT2G15310 Length:205 Species:Arabidopsis thaliana


Alignment Length:175 Identity:98/175 - (56%)
Similarity:126/175 - (72%) Gaps:4/175 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKLLSKI----FGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNV 61
            ||...|:|    ....::||||:|||.:||||||||||||:.|||:||:|||:|||.||.:.|.|
plant     1 MGARFSRIAKRFLPKSKVRILMVGLDGSGKTTILYKLKLGEVVTTVPTIGFNLETVEYKGINFTV 65

  Fly    62 WDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARTELHRIINDREMRDAIILIFANKQDL 126
            ||:|||:|||.|||||:...||||||||.:|.:|:.|||.|||||:.|.|:..|.:|:||||||.
plant    66 WDIGGQEKIRKLWRHYFQNAQGLIFVVDSSDSERLSEARNELHRILTDNELEGACVLVFANKQDS 130

  Fly   127 PDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLSEGLIWLTS 171
            .:|:...|:..||||..:..|.|.:|.:.|.||.||.|||.||::
plant   131 RNALPVAEVANKLGLHSLSKRCWLIQGTSAISGQGLYEGLEWLST 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf51FNP_523751.2 P-loop_NTPase 1..174 CDD:422963 98/175 (56%)
ARFB1ANP_179133.1 P-loop_NTPase 1..180 CDD:304359 98/175 (56%)
Ras 19..179 CDD:278499 94/157 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 1 1.010 - - D1362554at2759
OrthoFinder 1 1.000 - - FOG0000118
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.890

Return to query results.
Submit another query.