DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf51F and Arl4d

DIOPT Version :9

Sequence 1:NP_523751.2 Gene:Arf51F / 36699 FlyBaseID:FBgn0013750 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_079680.1 Gene:Arl4d / 80981 MGIID:1933155 Length:201 Species:Mus musculus


Alignment Length:159 Identity:68/159 - (42%)
Similarity:102/159 - (64%) Gaps:6/159 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 MRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTY-----KNVKFNVWDVGGQDKIRPL 73
            :.::::|||:||||::||:||..:.|.::||.|||.|.:..     :.:.|.|||||||:|:|||
Mouse    22 LHVVVIGLDSAGKTSLLYRLKFKEFVQSVPTKGFNTEKIRVPLGGSRGITFQVWDVGGQEKLRPL 86

  Fly    74 WRHYYTGTQGLIFVVDCADRDRIDEARTELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEK 138
            ||.|...|.||:||||.|:.:|::|||.|||||....:.:...:|:.|||||.|.|:...|::::
Mouse    87 WRSYTRRTDGLVFVVDSAETERLEEARMELHRISKASDNQGVPVLVLANKQDQPGALSAAEVEKR 151

  Fly   139 LGLTRIRDRN-WYVQPSCATSGDGLSEGL 166
            |.:..:.... .:||...|..|.||..||
Mouse   152 LAVRELAAATLTHVQGCSAVDGLGLQPGL 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf51FNP_523751.2 P-loop_NTPase 1..174 CDD:422963 68/159 (43%)
Arl4dNP_079680.1 Arl4_Arl7 19..201 CDD:206719 68/159 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D587782at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.