DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf51F and Arl15

DIOPT Version :9

Sequence 1:NP_523751.2 Gene:Arf51F / 36699 FlyBaseID:FBgn0013750 Length:175 Species:Drosophila melanogaster
Sequence 2:XP_038959439.1 Gene:Arl15 / 689079 RGDID:1597407 Length:278 Species:Rattus norvegicus


Alignment Length:178 Identity:56/178 - (31%)
Similarity:83/178 - (46%) Gaps:29/178 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHY 77
            |..::.:||..:|||::|.||........:.|.||:::.|.::|...||.::||.|.||..|..|
  Rat    85 EYDLVCIGLTGSGKTSLLSKLCSESPENVVSTTGFSIKAVPFQNAVLNVKELGGADNIRKYWSRY 149

  Fly    78 YTGTQGLIFVVDCA-DRDRIDEARTELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKL-- 139
            |.|:||:|||:|.| ..|.::.||.|||..:...::.....||.||.||.|.|   ..:||.:  
  Rat   150 YQGSQGVIFVLDSASSEDDLETARNELHSALQHPQLCTLPFLILANHQDKPAA---RSVQESVHG 211

  Fly   140 ----GLTRI-------------------RDRNWYVQPSCATSGDGLSE 164
                |...|                   |.:.|.:||......|.|.:
  Rat   212 SKCCGTPLIIGNVISSHIKKYFELEPLARGKRWILQPCSLDDVDALKD 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf51FNP_523751.2 P-loop_NTPase 1..174 CDD:422963 56/178 (31%)
Arl15XP_038959439.1 P-loop_NTPase 87..267 CDD:422963 55/176 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.