DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf51F and Arl1

DIOPT Version :9

Sequence 1:NP_523751.2 Gene:Arf51F / 36699 FlyBaseID:FBgn0013750 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_071780.1 Gene:Arl1 / 64187 RGDID:621326 Length:181 Species:Rattus norvegicus


Alignment Length:171 Identity:95/171 - (55%)
Similarity:126/171 - (73%) Gaps:0/171 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQD 68
            :.|.:||.:|||||:||||.||||||||:|::|:.||||||:|||||||||||:||.|||:|||.
  Rat     8 IFSSLFGTREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGQT 72

  Fly    69 KIRPLWRHYYTGTQGLIFVVDCADRDRIDEARTELHRIINDREMRDAIILIFANKQDLPDAMKPH 133
            .|||.||.||:.|..:|:|||..|||||..:::||..::.:.|:|.||:::||||||:..||.|.
  Rat    73 SIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTPS 137

  Fly   134 EIQEKLGLTRIRDRNWYVQPSCATSGDGLSEGLIWLTSNHK 174
            |:...|||..::||.|.:..:.||.|.||.|.:.||....|
  Rat   138 EMANALGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLK 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf51FNP_523751.2 P-loop_NTPase 1..174 CDD:422963 94/169 (56%)
Arl1NP_071780.1 Arl1 19..176 CDD:206718 89/156 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.