DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf51F and arl15a

DIOPT Version :9

Sequence 1:NP_523751.2 Gene:Arf51F / 36699 FlyBaseID:FBgn0013750 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001093503.1 Gene:arl15a / 567657 ZFINID:ZDB-GENE-070209-3 Length:206 Species:Danio rerio


Alignment Length:161 Identity:51/161 - (31%)
Similarity:89/161 - (55%) Gaps:2/161 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHY 77
            |..::.:||..||||::|.:|....|..|:||.||:::.|.::|...||.::||.:.|:..|..|
Zfish    34 EYDVVCIGLSGAGKTSLLSRLCNEISDGTVPTTGFSIKAVPFENAILNVKELGGAETIKKYWSRY 98

  Fly    78 YTGTQGLIFVVDCADRD-RIDEARTELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGL 141
            |.|:||::||::.|..| .::.:|:|||..:...::.....|:.||.||.|.|....||::...|
Zfish    99 YQGSQGVVFVLNSAASDEEMEASRSELHLALQHPQLCTLPFLVLANHQDSPAARSVSEIRKFFEL 163

  Fly   142 TRI-RDRNWYVQPSCATSGDGLSEGLIWLTS 171
            ..: |.:.|.:..:...:.:.:.|....|.|
Zfish   164 EPLARGKRWILAGTSTNNMEDVKESFSQLIS 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf51FNP_523751.2 P-loop_NTPase 1..174 CDD:422963 51/161 (32%)
arl15aNP_001093503.1 RAB 35..193 CDD:197555 48/157 (31%)
P-loop_NTPase 36..195 CDD:304359 50/159 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.