DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf51F and arl4cb

DIOPT Version :9

Sequence 1:NP_523751.2 Gene:Arf51F / 36699 FlyBaseID:FBgn0013750 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_998413.1 Gene:arl4cb / 406531 ZFINID:ZDB-GENE-040426-2382 Length:192 Species:Danio rerio


Alignment Length:172 Identity:78/172 - (45%)
Similarity:114/172 - (66%) Gaps:6/172 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKLLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETV-----TYKNVKFN 60
            ||...|.|...:.:.|:|||||:|||||:||:||..:.|.|:||:|||.|.:     |.|.:..:
Zfish     1 MGNSFSNISAFQSLHIVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCH 65

  Fly    61 VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARTELHRIINDREMRDAIILIFANKQD 125
            .||||||:|:||||:.|...|.|:|:|||..|.||::||:||||::....|.:...:|:.|||||
Zfish    66 FWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQD 130

  Fly   126 LPDAMKPHEIQEKLGLTRIRDRNWY-VQPSCATSGDGLSEGL 166
            ||.::...:|:::|.|..:.....| :||:||..|:||.||:
Zfish   131 LPKSLSVADIEKQLALQELTPATTYHIQPACAIIGEGLHEGM 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf51FNP_523751.2 P-loop_NTPase 1..174 CDD:422963 78/172 (45%)
arl4cbNP_998413.1 Arl4_Arl7 11..192 CDD:206719 74/162 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D587782at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.