DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf51F and Arf79F

DIOPT Version :9

Sequence 1:NP_523751.2 Gene:Arf51F / 36699 FlyBaseID:FBgn0013750 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001097667.1 Gene:Arf79F / 40506 FlyBaseID:FBgn0010348 Length:182 Species:Drosophila melanogaster


Alignment Length:171 Identity:122/171 - (71%)
Similarity:143/171 - (83%) Gaps:0/171 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQD 68
            |...:||.|||||||:|||||||||||||||||:.||||||:|||||||.|||:.|.||||||||
  Fly     8 LFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQD 72

  Fly    69 KIRPLWRHYYTGTQGLIFVVDCADRDRIDEARTELHRIINDREMRDAIILIFANKQDLPDAMKPH 133
            |||||||||:..|||||||||..||:||.|||.||.|::.:.|:|||::||||||||||:||...
  Fly    73 KIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAA 137

  Fly   134 EIQEKLGLTRIRDRNWYVQPSCATSGDGLSEGLIWLTSNHK 174
            ||.:||||..:|:||||:|.:||||||||.|||.||::..|
  Fly   138 EITDKLGLHSLRNRNWYIQATCATSGDGLYEGLDWLSNQLK 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf51FNP_523751.2 P-loop_NTPase 1..174 CDD:422963 121/169 (72%)
Arf79FNP_001097667.1 ARF 5..179 CDD:128474 122/171 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455867
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D102611at33392
OrthoFinder 1 1.000 - - FOG0000118
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11711
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.