DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf51F and arf3b

DIOPT Version :9

Sequence 1:NP_523751.2 Gene:Arf51F / 36699 FlyBaseID:FBgn0013750 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001012248.1 Gene:arf3b / 368822 ZFINID:ZDB-GENE-030616-356 Length:181 Species:Danio rerio


Alignment Length:173 Identity:121/173 - (69%)
Similarity:143/173 - (82%) Gaps:0/173 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKLLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGG 66
            |.||..:.|.|||||||:|||||||||||||||||:.||||||:|||||||.|||:.|.||||||
Zfish     6 GNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGG 70

  Fly    67 QDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARTELHRIINDREMRDAIILIFANKQDLPDAMK 131
            |||||||||||:..|||||||||..||:|::|||.||.|::.:.|:|||::|:||||||||:||.
Zfish    71 QDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMN 135

  Fly   132 PHEIQEKLGLTRIRDRNWYVQPSCATSGDGLSEGLIWLTSNHK 174
            ..||.:||||..:|.||||:|.:||||||||.|||.||.:..|
Zfish   136 AAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLK 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf51FNP_523751.2 P-loop_NTPase 1..174 CDD:422963 120/171 (70%)
arf3bNP_001012248.1 P-loop_NTPase 5..179 CDD:422963 121/173 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 1 1.010 - - D1362554at2759
OrthoFinder 1 1.000 - - FOG0000118
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.