DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf51F and CG13692

DIOPT Version :9

Sequence 1:NP_523751.2 Gene:Arf51F / 36699 FlyBaseID:FBgn0013750 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_608523.1 Gene:CG13692 / 33216 FlyBaseID:FBgn0031254 Length:193 Species:Drosophila melanogaster


Alignment Length:189 Identity:47/189 - (24%)
Similarity:79/189 - (41%) Gaps:39/189 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LMLGLDAAGKTTILYKLKLGQSV--TT--IPTVGFNVETVTY----------------------- 54
            :.||...||||.:|..|:..:|:  ||  :||:|..:..:.:                       
  Fly     5 ICLGPKRAGKTHLLKALQDPESIDETTFSMPTIGTGIYRIHFPTKSPNGDKNKPPPSEAPANIPH 69

  Fly    55 --KNV--KFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARTELHRIIND-REMRD 114
              ||:  ...:.::||  .:.||||.|:...:.||:|||.::..:|..|....:.|:.: |...:
  Fly    70 GGKNLPKSIQILEIGG--SMAPLWRQYFEDVKKLIYVVDTSNLCQISAAGVLFYSILTEPRLQHN 132

  Fly   115 AIILIFANKQDLPDAMKPHE----IQEKLGLTRIRDRNWYVQPSCATSGDGLSEGLIWL 169
            ..||:...|.|.......:|    :|.:....:||.:...|:.|..|. .||.....||
  Fly   133 TKILLVLAKMDYSYRQMRNEALLMLQMQKLQKQIRQQVTIVEASAVTK-VGLDPIYDWL 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf51FNP_523751.2 P-loop_NTPase 1..174 CDD:422963 47/189 (25%)
CG13692NP_608523.1 P-loop_NTPase 4..191 CDD:304359 47/189 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455826
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.