DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arf51F and arf2b

DIOPT Version :9

Sequence 1:NP_523751.2 Gene:Arf51F / 36699 FlyBaseID:FBgn0013750 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_958888.1 Gene:arf2b / 327026 ZFINID:ZDB-GENE-030131-5234 Length:181 Species:Danio rerio


Alignment Length:171 Identity:120/171 - (70%)
Similarity:143/171 - (83%) Gaps:0/171 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQD 68
            |...:||.|||||||:|||||||||||||||||:.||||||:|||||||.|||:.|.||||||||
Zfish     8 LFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQD 72

  Fly    69 KIRPLWRHYYTGTQGLIFVVDCADRDRIDEARTELHRIINDREMRDAIILIFANKQDLPDAMKPH 133
            |||||||||:..|||||||||..||:|::|||.||.|::.:.|:|||::|:||||||||:||...
Zfish    73 KIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLVFANKQDLPNAMNAA 137

  Fly   134 EIQEKLGLTRIRDRNWYVQPSCATSGDGLSEGLIWLTSNHK 174
            ||.:||||..:|.||||:|.:||||||||.|||.||::..|
Zfish   138 EITDKLGLHALRHRNWYIQATCATSGDGLYEGLDWLSNQLK 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arf51FNP_523751.2 P-loop_NTPase 1..174 CDD:422963 119/169 (70%)
arf2bNP_958888.1 P-loop_NTPase 5..179 CDD:422963 120/171 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362554at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11711
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.